ORFeome > tia1 – XORFeome 2.0

tia1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis TIA1 cytotoxic granule-associated RNA binding protein, mRNA (cDNA clone MGC:75625 IMAGE:5379389), complete cds
Gene Symbol: tia1
Gene ID: 394890
ORF gb_acc: MG132840
ORF ID: 10191

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064164

Library Location

Plate ID: GDExt11002
Well Location: C09

EST Sequences

Clone: MGC:75625 IMAGE:5379389
Trimmed Sequence: ATGGAGGAAGATCTTCCCAGAACGCTGTATGTGGGAAATCTCTCTAGGGATGTGACAGAACCTTTGATTCTTCAGGTGTTTAGCCAACTCGGTCCATGCAAAAGCTGCAAGATGATTATGGATACTGCTGGAAATGATCCCTACTGCTTTGTAGAGTTCTTTGAGCACCGACATGCAGCTGCATCTTTAGCAGCTATGAATGGCCGAAAGATAATGGGCAAGGAAGTAAAAGTCAACTGGGCCACTACGCCAAGCAGCCAGAAAAAGGATGCAAATAGTAGTTCCGTTGTCAGCACACTGCGTTCTCAAGATCATTTCCATGTCTTTGTTGGTGACTTGAGCCCAGAGATCACGACTGATGATATAAAAGCTGCTTTTGCACCATTTGGGAGAATATCAGATGCCCGTGTGGTTAAAGATATGACAACTGGAAAATCCAAGGGTTATGGATTCGTGTCCTTCTTTAATAAATGGGATGCAGAAAATGCCATTGCACAGATGGGAGGCCAGTGGCTTGGGGGTCGACAGATTAGAACTAACTGGGCCACAAGAAAACCTCCAGCGCCAAAGAGCACCTATGAATCCAACACAAAGCAGTTAACTTATGAGGAAGTTGTCAACCAGTCAAGTCCCAGTAATTGTACTGTGTACTGTGGCGGCGTCACAAGTGGACTAACTGAACAACTCATGCGACAAACCTTTTCACCTTTTGGTCAAATAATGGAAGTCAGAGTCTTTCCAGATAAAGGCTACTCCTTTGTACGGTTTAGTTCCCATGAAAGCGCAGCTCATGCTATTGTCAGTGTCAATGGAACTACTATTGAAGGGCATGTGGTAAAGTGTTACTGGGGAAAGGAGACCCCAGATATGCTAAATCCTGTTCAGCAGGCAAGCCAAATTAGCTTTCCCCCACCATATGGCCAGTGGGGTCAGTGGTACGGTGGGGCTCAACAAATAGGCCAGTATGTGCCCAATGGCTGGCAAATGCCAGCATATGGGGTGTATGGACAGGCATGGAATCAGCAGGGATATAGTCAAACGCCATCGTCTGCTGCCACATGGGTGGGACCAAATTACGGGGTGCAACCTCAGCCTGGCCAGAATGGGACTCTGATCACGAACCAAACTGGCTATCGAATGGCTGGATACCAAACCCAATGA
Full Trace Sequence: ggcgaaagtgtgaggaaaacagagaaagtgaagccagaaagagaaatatcggacgttctgccgcctcgcccccctacccaagaataaaccaagccccctttttcttcttttctttttgtaaccgggctacccttcggggcccaggacagagcggggcccagagcttggaaccatggaggaagatcttcccagaacgctgtatgtgggaaatctctctagggatgtgacagaacctttgattcttcaggtgtttagccaactcggtccatgcaaaagctgcaagatgattatggatactgctggaaatgatccctactgctttgtagagttctttgagcaccgacatgcagctgcatctttagcagctatgaatggccgaaagataatgggcaaggaagtaaaagtcaactgggccactacgccaagcagccagaaaaaggatgcaaatagtagttccgttgtcagcacactgcgttctcaagatcatttccatgtctttgttggtgacttgagcccagagatcacgactgatgatataaaagctgcttttgcaccatttgggagaatatcagatgcccgtgtggttaaagatatgacaactggaaaatccaagggttatggattcgtgtccttctttaataaatgggatgcagaaaatgccattgcacagatgggaggccagtggcttgggggtcgacagattagaactaactgggccacaagaaaacctccagcgccaaagagcacctatgaatccaacacaaagcagttaacttatgaggaagttgtcaaccagtcaagtcccagtaattgtactgtgtactgtggcggcgtcacaagtggactaactgaacaactcatgcgacaaaccttttcaccttttggtcaaataatggaagtcagagtctttccagataaaggctactcctttgtacggtttagttcccatgaaagcgcagctcatgctattgtcagtgtcaatggaactactattgaagggcatgtggtaaagtgttactggggaaaggagaccccagatatgctaaatcctgttcagcaggcaagccaaattagctttcccccaccatatggccagtggggtcagtggtacggtggggctcaacaaataggccagtatgtgcccaatggctggcaaatgccagcatatggggtgtatggacaggcatggaatcagcagggatatagtcaaacgccatcgtctgctgccacatgggtgggaccaaattacggggtgcaacctcagcctggccagaatgggactctgatcacgaaccaaactggctatcgaatggctggataccaaacccaatgagaggaaggactcccagccgcaccggcagcctaatgctggcccctttgtttactttgatactattataaaattacatcaatacagatgtcaaatacagtatatttattaaaacaacaaaaatccaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MEEDLPRTLYVGNLSRDVTEPLILQVFSQLGPCKSCKMIMDTAGNDPYCFVEFFEHRHAAASLAAMNGRKIMGKEVKVNWATTPSSQKKDANSSSVVSTLRSQDHFHVFVGDLSPEITTDDIKAAFAPFGRISDARVVKDMTTGKSKGYGFVSFFNKWDAENAIAQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLTYEEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEVRVFPDKGYSFVRFSSHESAAHAIVSVNGTTIEGHVVKCYWGKETPDMLNPVQQASQISFPPPYGQWGQWYGGAQQIGQYVPNGWQMPAYGVYGQAWNQQGYSQTPSSAATWVGPNYGVQPQPGQNGTLITNQTGYRMAGYQTQ
Donor tissue: tailbud