ORFeome > tpm1 – XORFeome 2.0

tpm1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis tropomyosin 1 (alpha), mRNA (cDNA clone MGC:79805 IMAGE:6986518), complete cds
Gene Symbol: tpm1
Gene ID: 448541
ORF gb_acc: MG133750
ORF ID: 11319

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC076711

Library Location

Plate ID: GDExt11013
Well Location: A05

EST Sequences

Clone: MGC:79805 IMAGE:6986518
Trimmed Sequence: ATGGCCGGAATAACTTCTTTGGAGGCCGTCAAGAGAAAGATCAAATGCCTGCAAGATCAGGCAGATGCGGCGGAGGAGAGAGCAGAGAAGCTTCAGAGGGAGCGGGATATGGAAAGGAAACAGAGAGAAGCAGCTGAAGGAGATGTAGCCTCATTGAACAGGCGCATCCAGCTGGTAGAGGAGGAGTTGGATCGTGCTCAGGAGCGTCTGGCCACAGCTCTTCAGAAACTGGAGGAGGCTGAGAAGGCTGCAGATGAGAGTGAGAGAGGTATGAAGGTCATTGAAAACAGAGCCCTGAAGGATGAAGAGAAAATGGAACTGCAAGAAATCCAGCTGAAAGAGGCCAAGCACATTGCTGAGGAGGCTGACCGCAAATATGAAGAGGTTGCTCGTAAGCTGGTGATCATTGAGGGTGACCTGGAACGTGCAGAGGAACGTGCTGAACTTTCAGAAAGCCGTTACCGGCAGCTGGACGATCAGCTGAGAATAATGGACCAAACCCTGAAAACATTAATGGCTGCAGAGGAGAAGTACTCCCAGAAGGAGGACAAATATGAAGAGGAAATTAAGGTTCTCACAGATAAACTGAAGGAGGCTGAAACACGTGCCGAGTTTGCAGAGAGGACAGTAGCCAAGTTGGAAAAGACCATTGATGATTTAGAAGAAAAAGTGACACATGCTAAGGAAGAAAACTTAAATATGCATCAGATGTTGGACCAGACACTGCTGGAATTAAATAACATGTAA
Full Trace Sequence: tacagtcttagggcagtgatgtggggctgcaggtatttctaggtgtgatatgcgcgcagtcatttaatgatagggttaatttaaggggctggagcctatgtaaggaggagacttcctgtgtgcctactgagcaagtcacagcgagagacaggggaagcactgagagtacaggctttgtacagccgggctgaagggaaagtaggcggaagggacgctactgtgtgagagaaatggccggaataacttctttggaggccgtcaagagaaagatcaaatgcctgcaagatcaggcagatgcggcggaggagagagcagagaagcttcagagggagcgggatatggaaaggaaacagagagaagcagctgaaggagatgtagcctcattgaacaggcgcatccagctggtagaggaggagttggatcgtgctcaggagcgtctggccacagctcttcagaaactggaggaggctgagaaggctgcagatgagagtgagagaggtatgaaggtcattgaaaacagagccctgaaggatgaagagaaaatggaactgcaagaaatccagctgaaagaggccaagcacattgctgaggaggctgaccgcaaatatgaagaggttgctcgtaagctggtgatcattgagggtgacctggaacgtgcagaggaacgtgctgaactttcagaaagccgttaccggcagctggacgatcagctgagaataatggaccaaaccctgaaaacattaatggctgcagaggagaagtactcccagaaggaggacaaatatgaagaggaaattaaggttctcacagataaactgaaggaggctgaaacacgtgccgagtttgcagagaggacagtagccaagttggaaaagaccattgatgatttagaagaaaaagtgacacatgctaaggaagaaaacttaaatatgcatcagatgttggaccagacactgctggaattaaataacatgtaaaatacatcagtcgcgtgttcctcagcttggttttctgaagtccctgcttgtcaatatttttgctcttttgagtgcaagtggaatcagccccttgtttttgttattgctgaaccattctagcactcaaaggcttatataaaaaaatctttgggggagaacgaatgggagggttaggtttatttgtatttttttttaatttatgcagcctatagaatgggtttcattctacccatggaattaaagtggggactgggacaatgggtgatctgaatacaatcagacatggtgccaattatacagagcctcttgttaatgaccaaaacaattgcacaggtataaaccatttattttatgtctataaaacagcatggggtttttttttgtatttttttttttttttaaatatttgccataaattctgataaaacaggatctcctcacctctgtcacaatagggttttgttgaaaattgttttccatttcttagacaaatctatgcaacataagctttttctgtagctttctattacaatgtaaaattgaaagtatttcattcaaatgtcatgttttctgtagcaacataatatatgtggggtggcagaggataaagtggtggtggacagatcaaccctactttgtgttttgatagtctttctgtggttgtttaaagtagatgcaaacatggatttttttggaaagacaatttttgatataactctttttcataaaggcaaatggtaaatttacataccaagggaaatcatgtacagtatggtgttggaggctcaacctagagaccacagaaaatcctaaagtacttgacaaagctcaaacagttgttttcaaaaacaattctttttaaagatttgtcttatttaaaatatgcagtgctttttaggaattggagctggttaaaaagtggtgtaaatttatattttgatggttcaagacaaaaaaattcagatccttcatcggcaaagtttacagcatgttttcttgtatggtctagcatttccctgtactattttgttttgtttctgatccagtggttaaaataaaaaaaatcagataaacccagaataatttaaacttgggaaaaattagctatctgttttggatataaattttttgcgaagcctcacttttttatttttacactagtttttaagattacaaccaaaaatgtacaacattgtaacatgaaataaaatgcacacttgaaatttaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAGITSLEAVKRKIKCLQDQADAAEERAEKLQRERDMERKQREAAEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERAEERAELSESRYRQLDDQLRIMDQTLKTLMAAEEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERTVAKLEKTIDDLEEKVTHAKEENLNMHQMLDQTLLELNNM
Donor tissue: gastrula