ORFeome > trappc6a – XORFeome 2.0

trappc6a – XORFeome 2.0

General Information

Species: Xenopus tropicalis trafficking protein particle complex 6A, mRNA (cDNA clone MGC:69483 IMAGE:5336244), complete cds
Gene Symbol: trappc6a
Gene ID: 407891
ORF gb_acc: MG133369
ORF ID: 10874

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC067951

Library Location

Plate ID: GDExt11008
Well Location: C06

EST Sequences

Clone: MGC:69483 IMAGE:5336244
Trimmed Sequence: ATGGCAGACGAGACCCTGTTTGAGCTTTTGCACATGGAGATGGTTTCTCATGTATACGAGCACGTGGAGGAGGATGAAGAGGATCATGGGAAACACACACGTGTCTTAGAGGGTATGGGGTTTCGTGTGGGCCAAGGACTTATCGAAAGGTTGACCAAGGATAGCCCATCTTTCAAAGATGATCTGGAAGTTGTGAAGTTTGTTTGTAAGGATTTTTGGACAATTCTCTTTAAGAAACAAATTGATAATCTACGAACAAACCATCAGGGTACCTATGTTCTACAAGACAACAGGTTTATGCTACTGACACAACTTTCCTCAAGTAAACAATATTTGGAGGAAGCACCAAAGTTCTTACCCTACACCTGTGGTCTTATTAAAGGAGCGCTCTCAAATTTAGGGATTAGTTGTACAGTTTCAGCAGAGGTTGTTGTAATGCCAGCCTGTAAATTCCAAGTTGTTATTTCAAGGACATAG
Full Trace Sequence: ggagtggcctgtagagaagaactagctttgaggaagtgttggtttattagagaaccgagggaggttccgacatggcagacgagaccctgtttgagcttttgcacatggagatggtttctcatgtatacgagcacgtggaggaggatgaagaggatcatgggaaacacacacgtgtcttagagggtatggggtttcgtgtgggccaaggacttatcgaaaggttgaccaaggatagcccatctttcaaagatgatctggaagttgtgaagtttgtttgtaaggatttttggacaattctctttaagaaacaaattgataatctacgaacaaaccatcagggtacctatgttctacaagacaacaggtttatgctactgacacaactttcctcaagtaaacaatatttggaggaagcaccaaagttcttaccctacacctgtggtcttattaaaggagcgctctcaaatttagggattagttgtacagtttcagcagaggttgttgtaatgccagcctgtaaattccaagttgttatttcaaggacatagttggactaaagaagaggactttttgctttttctgggagtacaaatatatctaggatggaaagcaataatatgggctatgcaatattttagatttaaggagtgttattttaagaggggacatgctgccttgatttctaacttattgactcattgctgaagacccccagcctgctctgaatcaacatatacccctacctcttcaaaccttactgccgggtttgctacctaatggcagtgcagggggattaacagctgccatgtgacttctgcctggactccacatatcaatagtcttttagtgcacatgcatctgcctatctgtggtcttggcccagggtcagcaatctgcacagtccaggctggaaatgaaattgacatgccaccaagcctgctgtgatttggataggcaaaaccagcaaacagttatgtttggaggaggtggattcatgggattggaaaataagcttgaagtcaacaagttaaaatgagggggggtttcctgcttaaaaatgttttaatttaattaacaattacccaatttggggataaacctcaggaattttcactatacaagcagaaacatgagtatcaggcataaaatttcagattctctaatctgtaaacaaatagaaagttggattataactcttaatgggtatgtttttaggagttaggcaggtactcatgaaatccaatgtgaacatgagtgagaaaagcaaaaacagtttattagtaaggtacataaaatcagcctcttatattgtttctttggggaaaaaaataagttcaaatgtataatatggtagtatgaagcatgtgacctaaagctgatgcctgacttacctttttagttaccaacatgcttctgccttcacttctgttggggacaaataataaccctgtaaaagacaataaccactattcttgtatactgttatttaatgtggtttactaagctagcaaaaaggattgacagtaaggctgccacttctctatagtgtttttttccgtacattatttttatactaaatattgactgctgtggagttcatgtatttttgctgtattgcattatatgtgtttgagtgggctattgtactgtgggttaaaactggcttggccattatatatggaagcatcattttgaacaataatatgaacagggtttaaaacttttaagccttgtgagtggtgattatctttgcgtcactgggaaaaaaaaaataaatacatacatacatgtaaaaaaaaaaaaaaaaaaaaaa
Translation: MADETLFELLHMEMVSHVYEHVEEDEEDHGKHTRVLEGMGFRVGQGLIERLTKDSPSFKDDLEVVKFVCKDFWTILFKKQIDNLRTNHQGTYVLQDNRFMLLTQLSSSKQYLEEAPKFLPYTCGLIKGALSNLGISCTVSAEVVVMPACKFQVVISRT
Donor tissue: tailbud