ORFeome > trit1 – XORFeome 2.0

trit1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis tRNA isopentenyltransferase 1, mRNA (cDNA clone MGC:108285 IMAGE:7021048), complete cds
Gene Symbol: trit1
Gene ID: 496761
ORF gb_acc: MG134783
ORF ID: 12527

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC088030

Library Location

Plate ID: GDExt11025
Well Location: B04

EST Sequences

Clone: MGC:108285 IMAGE:7021048
Trimmed Sequence: ATGGCTGCGCAGGGCTTGAGTCGCTCATTGCCGCTTGTAGTGGTTCTCGGAGCTACGGGGACCGGAAAGTCTAAATTGGCTGTGCAGCTTGGGCGGACACTTGGTGGGGAAATAATCAGCGCAGACTCCATGCAGGTCTACAAGGGACTGGACATTATCACTAATAAGGTCAGTGCAGAGGAGCAGAAACTGTGTACACACCACATGATCAGTTTTGTGGATCCTTTGGTCGCCAGTTACACAGTTGTAGACTTTCGAAACAAAGCCGTGACTCTGATTGAAGATATTTTCTCAAGAAACAAAATTCCAATTGTTGTGGGAGGAACAAATTACTATATTGAGTCTTTGCTTTGGAAAATTTTATTGAATACGGTAACAAGAGATGGAATAAAAAGTTCCATAAACAGCAATGAAAATACACAGACAGAAGGTAATAGGAAAGAAGAACTTGAGAAATTAGACAGCCACGAACTCCACTTGCGTCTCAAGCATGTGGACCCAGAGATGGCATCAAAGCTTCATCCAAATGACAAACGTAAAATTGCCAGGAGCCTGCAGGTGTATGAGGAATCTGGCATCCCCCACACTGAACATTTAAGGCGTCAGCAGGAAGAAAATGGAGGGGGACCTCTTGGTGGAGCCTTGAGGTACCAGAATCCCTGCATTTTATGGCTTCATGCTAATCAGGAAGATTTAAATTCTCGCCTAAATGCCAGAGTAGATGAGATGCTGAAACTTGGGTTGATCGAGGAGCTACAGGACTTTCACAAGCATTACAATGAGAAGCTCATAACTCAATCCAGGCAGGATTACCAGCATGGCATCTTTCAATCAATTGGTTTCAAGGAGTTTCATGAATACCTAATAAGTGAGAAAAGTGATTCAAGTGCAAAGGAGGTCCTGCTTCAGAAAGGTATTGAGAGTCTGAAGCAAAGAACACAGAAATATGCAAAGAAACAAAATCAATGGGTTCAGAACAGATTCCTTAAGCGCCCAGGACCTAATGTGCCCCGTGTGTACCGCTTAGACGTGACTGATGTCTCTGCTTGGGACCAGTGTGTTCTGTCACCTGCTCTGCAGATTGTCAACAGTTTTCTACAGGGAGAAGATCCAGCGATAGAGCCTCTGCTTCTTGACTGTGATGAAACTGTGAATAAGCGAAGTAGTCGCATATGTGATCTGTGCAGTAGAGTCATAATTGGTGATCGGGAATGGGCAGCTCACATCAAGTCTAAATCTCATCTTAATAATGCAAAAAAGAAGAGGAAATTAGAAGGTCAGTGTGATCTTGGAAACACCCAAGTGAAAAAGCGATTGTGCACCCAGGATTCAAAGAGTGTGAAAGAAAATGAAGATGAAGAAGAAGCAGCATAA
Full Trace Sequence: ggagagatggctgcgcagggcttgagtcgctcattgccgcttgtagtggttctcggagctacggggaccggaaagtctaaattggctgtgcagcttgggcggacacttggtggggaaataatcagcgcagactccatgcaggtctacaagggactggacattatcactaataaggtcagtgcagaggagcagaaactgtgtacacaccacatgatcagttttgtggatcctttggtcgccagttacacagttgtagactttcgaaacaaagccgtgactctgattgaagatattttctcaagaaacaaaattccaattgttgtgggaggaacaaattactatattgagtctttgctttggaaaattttattgaatacggtaacaagagatggaataaaaagttccataaacagcaatgaaaatacacagacagaaggtaataggaaagaagaacttgagaaattagacagccacgaactccacttgcgtctcaagcatgtggacccagagatggcatcaaagcttcatccaaatgacaaacgtaaaattgccaggagcctgcaggtgtatgaggaatctggcatcccccacactgaacatttaaggcgtcagcaggaagaaaatggagggggacctcttggtggagccttgaggtaccagaatccctgcattttatggcttcatgctaatcaggaagatttaaattctcgcctaaatgccagagtagatgagatgctgaaacttgggttgatcgaggagctacaggactttcacaagcattacaatgagaagctcataactcaatccaggcaggattaccagcatggcatctttcaatcaattggtttcaaggagtttcatgaatacctaataagtgagaaaagtgattcaagtgcaaaggaggtcctgcttcagaaaggtattgagagtctgaagcaaagaacacagaaatatgcaaagaaacaaaatcaatgggttcagaacagattccttaagcgcccaggacctaatgtgccccgtgtgtaccgcttagacgtgactgatgtctctgcttgggaccagtgtgttctgtcacctgctctgcagattgtcaacagttttctacagggagaagatccagcgatagagcctctgcttcttgactgtgatgaaactgtgaataagcgaagtagtcgcatatgtgatctgtgcagtagagtcataattggtgatcgggaatgggcagctcacatcaagtctaaatctcatcttaataatgcaaaaaagaagaggaaattagaaggtcagtgtgatcttggaaacacccaagtgaaaaagcgattgtgcacccaggattcaaagagtgtgaaagaaaatgaagatgaagaagaagcagcataagagttgtcaggtaactcgtgaagaggattcatgtgatcagtttgggatttacttgattattgaacacgggagcagaaaggcaagaggaacgtataacacaagacacacaaaaccctctccccccttgctgtctcaaatacagtgaaaatgcacagtgtattactggagcaaagctctgatctgcttggatgtggtgtcatcatttagatggcgggttgtatatctaagaaaaagaacaaacttatgttattaaatttgcatatattaataaactgtattaaggaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAAQGLSRSLPLVVVLGATGTGKSKLAVQLGRTLGGEIISADSMQVYKGLDIITNKVSAEEQKLCTHHMISFVDPLVASYTVVDFRNKAVTLIEDIFSRNKIPIVVGGTNYYIESLLWKILLNTVTRDGIKSSINSNENTQTEGNRKEELEKLDSHELHLRLKHVDPEMASKLHPNDKRKIARSLQVYEESGIPHTEHLRRQQEENGGGPLGGALRYQNPCILWLHANQEDLNSRLNARVDEMLKLGLIEELQDFHKHYNEKLITQSRQDYQHGIFQSIGFKEFHEYLISEKSDSSAKEVLLQKGIESLKQRTQKYAKKQNQWVQNRFLKRPGPNVPRVYRLDVTDVSAWDQCVLSPALQIVNSFLQGEDPAIEPLLLDCDETVNKRSSRICDLCSRVIIGDREWAAHIKSKSHLNNAKKKRKLEGQCDLGNTQVKKRLCTQDSKSVKENEDEEEAA
Donor tissue: