ORFeome > tspan14 – XORFeome 2.0

tspan14 – XORFeome 2.0

General Information

Species: Xenopus tropicalis tetraspanin 14, mRNA (cDNA clone MGC:89643 IMAGE:7025775), complete cds
Gene Symbol: tspan14
Gene ID: 493257
ORF gb_acc: MG133078
ORF ID: 10495

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC080135

Library Location

Plate ID: GDExt11005
Well Location: G06

EST Sequences

Clone: MGC:89643 IMAGE:7025775
Trimmed Sequence: ATGCACTACTACCGGTACAGCACTGCAGAAGTCAGCTGTTGTTATAAGTACCTCCTGTTTAGCTACAATATCATATTCTGGCTATCGGGAATGGTTCTTTTAGGAGTTGGTTTGTGGGCATGGAGTGAAAAAGGCATATTGTCAGATATTACAAAAGTAACACGTCTCCATGGATTTGACCCAGTGTGGCTAGTCCTGGTGGTTGGTGTCATCATGTTTACTCTTGGCTTTGCTGGCTGTGTTGGTGCTTTACGAGAAAATATCTGCCTTCTGAAATTTTTTTGTGGTGCTATAGTCTTGATTTTCTTCATGGAGCTCGCTGTTGCAGTTCTTGCCTTCCTATTCCAGGACTGGGTGAAAGACCGAGCCAAGGATTTTTTTGAGAACAATATAAAATCATACAGAGATGATATTGACTTGCAGAACCTCATAGATTCCCTTCAAAAAGCGAACCAGTGTTGTGGTGCTGTGTCCCCAGATGACTGGGACCTAAATGAATATTTCAACTGCAGTGTTGAAAATCCAAGTCGTGAGAGGTGTGGTGTTCCTTTTTCTTGTTGTGTTCCTGATCCAGCTCAAACAGTTGTGAACACACAGTGTGGTTATGATGCTCGCAGAAAGAAGCCCAACGAGAGACCAAATACAACATTCTCAAAAGGCTGTATATCTGCACTGGAGGCATGGTTACCGAGAAACATATATATTGTGGCTGGAGTTTTTCTAGTGATCTCAATTTTACAGATTTTTGGTATTTACCTTGCTCGGACACTGATGTCAGATATTGAAGCAGTGAAGGCCGGTTACCGCTTTTAA
Full Trace Sequence: cggctgtgttctgcttgtttgggttggatgctgtaattttcaacagggagagtttgcttagtccgggtatttttgctgtagccttttttttccctccgtgccatggaatcttgaaaaagtgttgtgatagtggggcagtgcggtaatcttaactgctgcaaacatgcactactaccggtacagcactgcagaagtcagctgttgttataagtacctcctgtttagctacaatatcatattctggctatcgggaatggttcttttaggagttggtttgtgggcatggagtgaaaaaggcatattgtcagatattacaaaagtaacacgtctccatggatttgacccagtgtggctagtcctggtggttggtgtcatcatgtttactcttggctttgctggctgtgttggtgctttacgagaaaatatctgccttctgaaatttttttgtggtgctatagtcttgattttcttcatggagctcgctgttgcagttcttgccttcctattccaggactgggtgaaagaccgagccaaggatttttttgagaacaatataaaatcatacagagatgatattgacttgcagaacctcatagattcccttcaaaaagcgaaccagtgttgtggtgctgtgtccccagatgactgggacctaaatgaatatttcaactgcagtgttgaaaatccaagtcgtgagaggtgtggtgttcctttttcttgttgtgttcctgatccagctcaaacagttgtgaacacacagtgtggttatgatgctcgcagaaagaagcccaacgagagaccaaatacaacattctcaaaaggctgtatatctgcactggaggcatggttaccgagaaacatatatattgtggctggagtttttctagtgatctcaattttacagatttttggtatttaccttgctcggacactgatgtcagatattgaagcagtgaaggccggttaccgcttttaagggcgaccctcatcgttcaaagtcattacagagactttctgtattttttcccatcttttaaatctttgtttgcagttagagacttttcaacattgccattatcaataaagatctgcacagaaggacccgttgtaattaatctagggtttccgtgcatcctgcaatatgtaaaaggatagacttgaaatgttactatatttaaccactagtcatttattattcctcctggaacttctccaagaagagactacactttgttttgaagaaaggttctctgaatctccctactattctggctttacattttccttcagcttttttcttcagtgctggaatatatgtcgacccggattacttattgatggacagtaaacattcatatgagttctctggacaatgaactcaggcatttaccttcatctaacaatgtcattaaaccttttttaaaccgaatgatttacaagttcaccaaagccttaccaagttaagacacgttcacttatgtcaataatgctgccatagatttttagaggtataacataacttttgtttgccaacatgtcaaggagtaatgttttactataaaaaaaatgtattactactgtaaatcattacattcacaagtatcttatttatggaaaggaaaaccaagtaatccccaaaaatactcaatttgaaatctaaacataagagatatcaagggctattagtctgggatttgactgtagttctttgtatttcactgttggagaaatataggttatcccaaaggaattatttctactgtgaaaagcaaatacatgattctctgttgatataaggacacaacagtgtcaacatcattgagttgttttttgttttgtttttttatataaaaaaaacccactatattattgcaggatatatgttcttttaccagagaatctgttgtagagttacgtgtttattttgtaaaaaaaattatatgggaaaaaattgaatatagctgtatctattgctttacagatgatcacagaagtctatagattttacttagtagcacaatttgttttaaatatgtacaatattatatacctgcatatccacacatacattaagggctgtgtgcccatttggagttacttctttcaaatggttccccagtaatgttaagagtagttattgtttcatttcagcgcttactctgtgtggctttagcagcacattcatgatttgataacagtttgcattcaggcttaggctggaaatgtattgtccatacaccagcatgatcaaattcagcatggcatttctaaatacacatttattgtataactaggaaggggcttgctcctgtgtcaagttctaaatgagctggtcctgacttagagccccgtttgaagatattgtttgtagtaaacaaactatggggcccacttcagccatctgactgaaatttgaaattaaccacgtattggggtatatttataaaagcctgccaaacattttgcagcaaaaacagtgtacatttggtggaacatagagagcatgtttatacagctcctgtatattttatttacgccatactaaccctgaaaataaaatcattgttttacaactctagactgtagacctatttaagtggtggttcacctttaagttaacttctaatatgttatattatggctaatttttggcaactttttgaattggtctaccttttttatttgtatagtttttttaattaatcgtgaccccccagcagccaaaaaaaaaaattttattgttattttttatactttatctttgtattcagaccctcttctatttatattgcagtctctcagactcaaactactgcctgtttgctagggtaagttagaccctagcaaccagtaggtactgaaatcccaaaccagagagctgaacaagaagctaaagaataagaataaaaaataaagaccaattgcacattgcattagaatagcactatctacatcaggggtccccaatctttcttactcgtaaaccacagccaaatgtaaaaagacttaggggagcaacaacaagtatcctaaaagttcatggaagtggcaaataagaactaaggttgcctattaggtagcctctatgaacacactcaacttacaagaggctttatttggtagtaaatcttttttcgtttttattcaaccaaagcttgccactgaggcacaaattaaaataataactacctggtttgggggcactgagagcaacaaccaaggggttggtgagcagcacgttacacacttctaaatataccctattatgtattccctaggtgtttactatttatggttgatttttaagttacccagttattcaataacagacattttcagcaaaaaaaaaaaaaaaa
Translation: MHYYRYSTAEVSCCYKYLLFSYNIIFWLSGMVLLGVGLWAWSEKGILSDITKVTRLHGFDPVWLVLVVGVIMFTLGFAGCVGALRENICLLKFFCGAIVLIFFMELAVAVLAFLFQDWVKDRAKDFFENNIKSYRDDIDLQNLIDSLQKANQCCGAVSPDDWDLNEYFNCSVENPSRERCGVPFSCCVPDPAQTVVNTQCGYDARRKKPNERPNTTFSKGCISALEAWLPRNIYIVAGVFLVISILQIFGIYLARTLMSDIEAVKAGYRF
Donor tissue: