ORFeome > tubb3 – XORFeome 2.0

tubb3 – XORFeome 2.0

General Information

Species: Xenopus tropicalis tubulin, beta 3, mRNA (cDNA clone MGC:76202 IMAGE:5336040), complete cds
Gene Symbol: tubb3
Gene ID: 395045
ORF gb_acc: MG132779
ORF ID: 10094

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064873

Library Location

Plate ID: GDExt11002
Well Location: E01

EST Sequences

Clone: MGC:76202 IMAGE:5336040
Trimmed Sequence: ATGAGGGAGATAGTGCACATCCAGGCCGGCCAGTGCGGCAACCAGATCGGGGCCAAGTTCTGGGAAGTCATCAGTGATGAACATGGTATTGACCCATGTGGAAACTATATTGGAGATTCTGACCTCCAGCTGGAGAGAATCAGCGTCTACTACAATGAAGCTTCCTCACACAAATATGTTCCCCGGGCAATCCTAGTGGATTTAGAACCAGGAACTATGGACAGTGTCCGCTCAGGAGCCTTTGGACATCTTTTCCGACCAGACAACTTCATATTTGGACAGAGCGGTGCTGGTAACAACTGGGCAAAGGGTCACTATACAGAAGGAGCTGAATTGGTGGACTCTGTGTTGGATGTAGTTCGCAAGGAGTGTGAGAACTGTGATTGTCTTCAAGGCTTCCAGCTCACTCATTCTCTGGGTGGGGGTACAGGCTCTGGAATGGGCACTCTTCTAATAAGTAAGGTCAGAGAGGAGTACCCTGACCGCATCATGAACACTTTTAGCGTTGTCCCTTCCCCAAAAGTATCTGACACAGTAGTTGAACCATATAACGCAACACTTTCTATCCACCAGCTGGTGGAAAATACAGATGAGACCTACTGCATTGACAATGAGGCTTTATATGACATCTGTTTCCGTACTCTCAAATTGGCTACTCCAACCTATGGTGACCTTAACCATCTGGTCAGTGCCACAATGAGTGGAGTGACAACTTCCCTGAGGTTCCCTGGCCAGCTCAATGCAGACTTGCGTAAGCTAGCAGTCAATATGGTACCTTTCCCTCGTCTGCACTTCTTCATGCCAGGGTTTGCACCACTGACTGCCCGTGGCAGCCAGCAGTATAGGGCACTGACTGTTCCTGAGCTCACCCAGCAGATGTTCGATGCCAAGAACATGATGGCCGCATGTGATCCTCGCCATGGGCGTTACCTAACTGTAGCCACTGTCTTCCGAGGACGCATGTCTATGAAGGAAGTGGATGAACAGATGCTTGCTATCCAGAGTAAGAATAGCAGCTATTTTGTGGAATGGATCCCCAATAATGTCAAAGTTGCTGTCTGCGACATTCCACCCCGTGGCCTCAAGATGTCTTCCACATTCATTGGCAACAGCACTGCCATTCAGGAGTTATTCAAGCGCATCTCTGAGCAATTCACTGCCATGTTCAGGCGCAAGGCTTTCTTGCACTGGTACACAGGAGAGGGCATGGATGAGATGGAATTCACAGAGGCTGAGAGCAACATGAATGATCTGGTGTCAGAATACCAGCAGTACCAAGACGCCACCGCAGAGGAAGAGGGAGAAATGTATGAAGATGATGAGGAGGAGTCTGAAGGTCAGGGGAAATAA
Full Trace Sequence: ccgagcagaaccgagtcacaatgagggagatagtgcacatccaggccggccagtgcggcaaccagatcggggccaagttctgggaagtcatcagtgatgaacatggtattgacccatgtggaaactatattggagattctgacctccagctggagagaatcagcgtctactacaatgaagcttcctcacacaaatatgttccccgggcaatcctagtggatttagaaccaggaactatggacagtgtccgctcaggagcctttggacatcttttccgaccagacaacttcatatttggacagagcggtgctggtaacaactgggcaaagggtcactatacagaaggagctgaattggtggactctgtgttggatgtagttcgcaaggagtgtgagaactgtgattgtcttcaaggcttccagctcactcattctctgggtgggggtacaggctctggaatgggcactcttctaataagtaaggtcagagaggagtaccctgaccgcatcatgaacacttttagcgttgtcccttccccaaaagtatctgacacagtagttgaaccatataacgcaacactttctatccaccagctggtggaaaatacagatgagacctactgcattgacaatgaggctttatatgacatctgtttccgtactctcaaattggctactccaacctatggtgaccttaaccatctggtcagtgccacaatgagtggagtgacaacttccctgaggttccctggccagctcaatgcagacttgcgtaagctagcagtcaatatggtacctttccctcgtctgcacttcttcatgccagggtttgcaccactgactgcccgtggcagccagcagtatagggcactgactgttcctgagctcacccagcagatgttcgatgccaagaacatgatggccgcatgtgatcctcgccatgggcgttacctaactgtagccactgtcttccgaggacgcatgtctatgaaggaagtggatgaacagatgcttgctatccagagtaagaatagcagctattttgtggaatggatccccaataatgtcaaagttgctgtctgcgacattccaccccgtggcctcaagatgtcttccacattcattggcaacagcactgccattcaggagttattcaagcgcatctctgagcaattcactgccatgttcaggcgcaaggctttcttgcactggtacacaggagagggcatggatgagatggaattcacagaggctgagagcaacatgaatgatctggtgtcagaataccagcagtaccaagacgccaccgcagaggaagagggagaaatgtatgaagatgatgaggaggagtctgaaggtcaggggaaataagggaacaactgcaaagccagagaacatcagaaataactccccgcaggtttaggaagtccactcatgctacatgtgttgcttctaagttaggattatagtaccctccagtttcagaacctgtgtctcattcctccattcccttaaattatctttttgctgccagagagcaatgcagtatttaatatgcgcatagctggtacgaagatgaagatgcttatttacagagggtcgatgtaccttgctgagcaaattgggggacattcattactaaaaggcgctgcttaaaaggttttgcaccttaaataacattttaatgcttggctgtttcgtcagcagaggtgtttacaacaggggaagtgtttttgtgatagtaattgagtctaacaaaggagaaagcttttaaggataggagtggcagataatagtaggtttgtattgactagtgtttaagcatataaacctccatgcttgtgttttagaggaggtttcctcccctaaagagcttaacttttaggcagagcagtaggaaatatgaaggtagctgtaggatgtgcgcataatgttttcttggaatctgacgggatattttgtgctaatagaaagttatgaacagttacagcaccgactgagacttacaccgcataatgctcaagcagcagaaagatctcccctgtcttacatacacatttgtttgtgtcttacatttctatctgttttgtctgatatcttttcatgtgttctgttttactgaattatttatttttaaataaataaacttcctgctgttcaacatgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaccaaaaaaaaaaaaaaaa
Translation: MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPCGNYIGDSDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEMYEDDEEESEGQGK
Donor tissue: tailbud