ORFeome > txnl1 – XORFeome 2.0

txnl1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis thioredoxin-like 1, mRNA (cDNA clone MGC:89177 IMAGE:7016540), complete cds
Gene Symbol: txnl1
Gene ID: 448593
ORF gb_acc: MG134204
ORF ID: 11855

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC076929

Library Location

Plate ID: GDExt11018
Well Location: G07

EST Sequences

Clone: MGC:89177 IMAGE:7016540
Trimmed Sequence: ATGGTGGGAGTGAAAGTCATCGGGGCGGACGGCGAGTTTCAGGGGGACCTGACCGCGGCCGGTTCCAGGCTCAGTGTGGTGAAGTTCACAATGAAAGGGTGTGCTCCTTGTGTAAGGATAGCGCCAGCCTTCACATCGCTGAGCAACAAATACCCACAAGCAATCTTTTTGGAAGTAGATGTACACCAGTGCCAAGCAACAGCCACTGCCAACAACATCTCTGCAACCCCCACATTTCTGTTCTTTAGAAATAAAGTAAAAATTGACCAGTACCAAGGGGCAGATGCTGCTGGTCTAGAGGACAAAATTAAACAGCACTTAGAAAATGATCCCGGAAACAACGAGGATGCTGATATTCCAAGAGGCTATATGGATTTGTTGCCATTTGTACATAAAGCCGGCTGTGAATGTCTCAATGAAAGCGATGATCATGGCTTTGAAAATTGTTTACGAAAAGACCCAACATACCTCGAGTCAGACTGCGATGAACAGCTGCTGATGACTGTAGCGTTTAGCCAGCCTGTGAAGTTGTATTCCATGAAACTACAAGGTCCAGATAATGGTCAAGGTCCCAAGTATGTTAAAATCTTTATTAACCTTCCCCGATCCATGGACTTTGACGAAGCGATGAGAAGCGAGCCCACCCAGGCCGTGGAGCTGTCAGCCGATGATATTAAAGAAGACAGCATCGTTCCGTTGCGCTATGTTAAATTTCAGAATGTTAACAGTGTAACGCTATTTGTCCAGTCCAATCAGGGTGACGAGGAGGCAACGAGAATCACATATTTAACTTTCATCGGGACCCCAGTACAAGCCACAAACATGAACGACTTCAAAAGAGTCGTAGGGAAGAAAGGAGAAAGCCACTGA
Full Trace Sequence: gcgtgagtgacgcggcagaaagtgttggtgccggtaggaaagagagagagagaagcggggcctaaacagacaccaatatggtgggagtgaaagtcatcggggcggacggcgagtttcagggggacctgaccgcggccggttccaggctcagtgtggtgaagttcacaatgaaagggtgtgctccttgtgtaaggatagcgccagccttcacatcgctgagcaacaaatacccacaagcaatctttttggaagtagatgtacaccagtgccaagcaacagccactgccaacaacatctctgcaacccccacatttctgttctttagaaataaagtaaaaattgaccagtaccaaggggcagatgctgctggtctagaggacaaaattaaacagcacttagaaaatgatcccggaaacaacgaggatgctgatattccaagaggctatatggatttgttgccatttgtacataaagccggctgtgaatgtctcaatgaaagcgatgatcatggctttgaaaattgtttacgaaaagacccaacatacctcgagtcagactgcgatgaacagctgctgatgactgtagcgtttagccagcctgtgaagttgtattccatgaaactacaaggtccagataatggtcaaggtcccaagtatgttaaaatctttattaaccttccccgatccatggactttgacgaagcgatgagaagcgagcccacccaggccgtggagctgtcagccgatgatattaaagaagacagcatcgttccgttgcgctatgttaaatttcagaatgttaacagtgtaacgctatttgtccagtccaatcagggtgacgaggaggcaacgagaatcacatatttaactttcatcgggaccccagtacaagccacaaacatgaacgacttcaaaagagtcgtagggaagaaaggagaaagccactgagagactacagagttaccatgggaggctcctagcaacgaggcccagtctccgatctccaggacaaagtgctttactagagaatgttcttgtctcactcagtggcattatcactaagtcattgctctttgttaagctgtttcataagtgattttatttggatctggcaaccgacatttgtaaataaacataacttttggcaagttccatttgtgacaccaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MVGVKVIGADGEFQGDLTAAGSRLSVVKFTMKGCAPCVRIAPAFTSLSNKYPQAIFLEVDVHQCQATATANNISATPTFLFFRNKVKIDQYQGADAAGLEDKIKQHLENDPGNNEDADIPRGYMDLLPFVHKAGCECLNESDDHGFENCLRKDPTYLESDCDEQLLMTVAFSQPVKLYSMKLQGPDNGQGPKYVKIFINLPRSMDFDEAMRSEPTQAVELSADDIKEDSIVPLRYVKFQNVNSVTLFVQSNQGDEEATRITYLTFIGTPVQATNMNDFKRVVGKKGESH
Donor tissue: