ORFeome > ube2g1 – XORFeome 2.0

ube2g1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog), mRNA (cDNA clone MGC:75869 IMAGE:5382941), complete cds
Gene Symbol: ube2g1
Gene ID: 394648
ORF gb_acc: MG133030
ORF ID: 10420

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC061341

Library Location

Plate ID: GDExt11004
Well Location: G07

EST Sequences

Clone: MGC:75869 IMAGE:5382941
Trimmed Sequence: ATGACGGAGTTGCAGTCGGCGCTTTTGCTGCGGAGGCAGCTTGCAGAGCTAAATAAGAATCCAGTAGAAGGTTTTTCAGCAGGCTTAATAGATGACAATGACTTATACCGATGGGAAGTTCTAATAATTGGCCCACCTGATACATTATATGAGGGTGGTGTTTTCAAGGCTCATCTCACCTTTCCAAGGGATTATCCTCTCCGGCCACCTAAGATGAAATTTATCACAGAAATATGGCACCCAAATGTTGATAAGAATGGTGATGTATGTATTTCCATTCTTCACGAACCCGGAGAAGACAAATATGGCTACGAGAAACCTGAGGAGCGCTGGCTACCTATCCATACAGTGGAAACCATAATGATCAGTGTAATTTCTATGCTAGCAGACCCTAATGGAGACTCTCCAGCAAATGTGGATGCAGCGAAAGAGTGGAGAGAAGACCGTAACGGTGAATTTAAAAGAAAAGTTGCCCGCTGTGTAAGAAAAAGCCAAGAAACAGCTTTCGAGTGA
Full Trace Sequence: gagacagagaagagaggagccggggagggagagagaggtgacgggccggaccagctgcgttgccccctcctcttgtgctaaaccttgtttctgctgttacgtgtgcgtcatttgtcttactacacactatgacggagttgcagtcggcgcttttgctgcggaggcagcttgcagagctaaataagaatccagtagaaggtttttcagcaggcttaatagatgacaatgacttataccgatgggaagttctaataattggcccacctgatacattatatgagggtggtgttttcaaggctcatctcacctttccaagggattatcctctccggccacctaagatgaaatttatcacagaaatatggcacccaaatgttgataagaatggtgatgtatgtatttccattcttcacgaacccggagaagacaaatatggctacgagaaacctgaggagcgctggctacctatccatacagtggaaaccataatgatcagtgtaatttctatgctagcagaccctaatggagactctccagcaaatgtggatgcagcgaaagagtggagagaagaccgtaacggtgaatttaaaagaaaagttgcccgctgtgtaagaaaaagccaagaaacagctttcgagtgacatttaaccagcagctagtagcttcacaatttcagggtctccatttgagaaacaaggcactgtttttcctgcactctacccaccttttgctggactttttgttgtaataagttggcaaacactggctggcactgggttgcaataaaacatgccagttatcaatgctgacaagagcctaacaagtgccaacttaaaggtgatctcgcatttcaaaatctaatgaactgctttaaacttcaggaagaattgtacagacctgtacatagcacaacatgatccggataatatatatactgttcatgtacatccataaatacacattgtaccaaataatgatttcttgttgtttagggtaagacttatgtaaaaagtggtgggaatgcaaatagggaagataaaatatgaaggagggaagaaagggagtgttttgcagtttaaattttcctgtcttctctccagcagatctgattggtctgtaaaaaaacaaatatgagattggaatccgttaaatttattgcttctagtgtccttttcctgacaagagctcttggaatcttttgaatcttccttctggtctcgcattggccactgtcctctctatgcagaaaaggccacattgttgtgtcagtgggcaatactgcattgatttgtctgtctttttttatttagctccaggaggttttagaaattctgtttgaggagcctgtcacccttgtcttttggggtttaatcacaggtgggatatgcaattacaataaaacaacttgttaacactgcatagtgaacaaagtactataaaaagaaattgagtgtctgatcacatatatacgtataggtggcataatgtcttcactttctattttctttggtcactgcaggaatttggttaccttttaagtgatcagccacatataacccctaaggggaagaagctctggtaattaaactcctgaagtgccttattgcaccctctaacaagtcctcaaaatcctcaggtcatgtgtgaaacttgactcccaaaggtggatatgtctaaacctgtgtgctgctcagcctggctgtagcaatggcttacttgctaccaagagcacccaaaaccctgctgctttaatgaactgaccagcatactttagtgattgcatttcctgtacaatcctcttcttggctgcctggtattgaaactgaaaaaggaaagcatgcataggtattggtttctcaaagtatcttcaggatttgacataattctgttccagtctctttttaaccttctgtatcaaactttttttgctcgcctccttacgttattttcatccttcttttacctttttatcgtcctgttgcagtttttcctcacctaatgtacaaagaaaaaattgcgatgtatattttcatgtaatttgattttggaattctgtcaccttctgtagtgcgttcttccaaaatataatttttttccaataaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPRDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE
Donor tissue: neurula