ORFeome > ube2m – XORFeome 2.0

ube2m – XORFeome 2.0

General Information

Species: Xenopus tropicalis ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast), mRNA (cDNA clone MGC:75750 IMAGE:5381472), complete cds
Gene Symbol: ube2m
Gene ID: 394553
ORF gb_acc: MG132965
ORF ID: 10341

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061289

Library Location

Plate ID: GDExt11004
Well Location: B02

EST Sequences

Clone: MGC:75750 IMAGE:5381472
Trimmed Sequence: ATGATCAAACTCTTCTCCCTCAAGCAGCAGAAGAAGGAGGAGGAATCTGCAGGGGGAACTAAAGGCAGCAGTAAAAAGGCCTCAGCCGCACAACTTCGCATTCAGAAAGATATTAACGAACTGAATTTGCCGAAGACATGTGAAATAGAGTTCTCAGACCACGATGATCTCTTAAATTTCAAATTAGTCATCTGCCCTGATGAGGGTTTCTACAAGGGTGGAAAATTTGTGTTCAGTTTTAAGGTCGGACAGGGCTACCCACATGACCCTCCAAAGGTGAAATGTGAAACCATGGTATATCATCCAAATATAGACCTAGAGGGCAATGTCTGCTTAAATATTCTAAGAGAGGACTGGAAGCCTGTACTCACAATAAATTCAATAATTTATGGCCTGCAGTATCTTTTCTTGGAGCCAAACCCTGAAGACCCATTAAATAAAGAAGCTGCTGAGGTTCTTCAGAACAACAGACGCCTGTTTGAACAGAATGTGCAGCGATCTATGCGGGGTGGTTACATAGGATCCACCTACTTTGAGCGCTGCTTGAAATAG
Full Trace Sequence: gcctgtctccccccggcctgtgtgtggcgagagagaaaaaagggacggaggggagggaggctgggagcttcccccagtgcgggacatagggagagcaggagggggttgagggaggtgcgggcccgcaggggggacatccagcaagatgatcaaactcttctccctcaagcagcagaagaaggaggaggaatctgcagggggaactaaaggcagcagtaaaaaggcctcagccgcacaacttcgcattcagaaagatattaacgaactgaatttgccgaagacatgtgaaatagagttctcagaccacgatgatctcttaaatttcaaattagtcatctgccctgatgagggtttctacaagggtggaaaatttgtgttcagttttaaggtcggacagggctacccacatgaccctccaaaggtgaaatgtgaaaccatggtatatcatccaaatatagacctagagggcaatgtctgcttaaatattctaagagaggactggaagcctgtactcacaataaattcaataatttatggcctgcagtatcttttcttggagccaaaccctgaagacccattaaataaagaagctgctgaggttcttcagaacaacagacgcctgtttgaacagaatgtgcagcgatctatgcggggtggttacataggatccacctactttgagcgctgcttgaaatagaacttgagcagctctgagtgcaaaacccgccatccatctgaccagctttcctgccctcacccagttatgtctcccatcgctcatttatcttgccttcattccctgccctaccctcccaaaagagaaaaaaaaacacaaacccagcctgagctcctgatgtagaaggaaatatgcaaggtggtcatgtgtctcctggtcctgctgctagccctttttatagaagggggaacactgagtgcagattgacttttaccgtacctttgtaatgccattgtttgaattctcattacctcaccttgctcttcttttctcatgcagagcatctgtttatctttaggttaataaatatatttcctctgccttcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCEIEFSDHDDLLNFKLVICPDEGFYKGGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK
Donor tissue: tadpole