ORFeome > ugp2 – XORFeome 2.0

ugp2 – XORFeome 2.0

General Information

Species: Xenopus tropicalis ugp2 protein, mRNA (cDNA clone MGC:79677 IMAGE:6980619), complete cds
Gene Symbol: ugp2
Gene ID: 493237
ORF gb_acc: MG133746
ORF ID: 11314

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC079947

Library Location

Plate ID: GDExt11013
Well Location: C01

EST Sequences

Clone: MGC:79677 IMAGE:6980619
Trimmed Sequence: ATGACTTCCTTTCCGGGAGGATTAAGGAACGCAATGGCGGGTGGAGGCATGTTACAGTTCCAGGAGGCCATCCGAGAGGAGCTGGAAGAAGCCATGAAGTCAGACTTGGAAAAAATTCTTTCCACGGCCCCTGAATCAGAATTAGAGCACATAAAGAAAGACCTTGCTGGTTTTCAGAAATTATTCCACAGATTTCTACAGGAAAAAGGTCCATCAGTGGACTGGGGAAAGATCCAGAGACCTCCAGAGGATTCTATTCAGCCATACGAGAAGATAAAGGCAAAAGGCCTTCCAGATAACATAGCTTCGGTCCTGAACAAGCTGGTTGTGGTAAAGCTTAATGGCGGTTTGGGTACAAGCATGGGCTGCAAAGGTCCCAAAAGCCTGATTGGCGTTCGTAATGAGAATACTTTCCTAGATCTTACTGTGAAGCAAATAGAGCACTTGAATACAGTATACAACACAGATGTTCCCCTTGTCCTGATGAACTCTTTCAACACAGATGAAGATACCAAGAAGATCCTACAGAAGTACAGTCACTGTCGAGTGAAGATTCATACTTTTAATCAGAGCAGGTACCCAAGGATAAGTAAGGAGTCACTATTGCCCATTGCCAAAGACTTGTCCTATTCTGTGGAAAATGCTGAGACGTGGTACCCCCCTGGTCATGGTGATATCTATGCCAGCTTTTATAATTCCGGCCTCCTAGACAGGCTCATAGGGGAAGGGAAGGAGTACATCTTTGTTTCCAACATTGACAATCTTGGGGCCACAGTGGACCTATATATCCTTAATCATCTCATGAATCCACCAAATGGCAAGAAATGTGAATTTGTCATGGAGGTGACTGACAAAACGAGGGCTGATGTCAAGGGTGGGACCCTCACTCAGTGCGAAGGGAAACTGAGGCTGGTGGAAATTGCCCAAGTGCCAAGAGCCCATGTAGATGAGTTTAAATCTGTCTCCAAGTTTAAGATCTTTAACACAAATAATTTGTGGATTTCCTTATCTGCAATCAAGAGGCTGCAAGAAGCCAATGCCATAGATATGGAAATCATTGTTAATCCCAAGACGTTGGATGGAGGATTAAATGTTATTCAGCTGGAGACGGCTGTTGGAGCAGCTATTAAAAGTTTTGAAAATTCTTTGGGTATCAATGTTCCTCGAAGCCGTTTCCTTCCTGTCAAGACCACGTCAGACCTTCTGCTTGTCATGTCCAACCTGTACAGCCTTCATGCCGGCTCCCTGACCATGAGCGAGAAGCGTGAGTTCCCCACCGTCCCACTCACCAAACTGGGAAGCTCCTTCACAAAGGTACAAGACTATTTGAAGAGATTTGAAAGTATTCCGGATATGCTGGAACTGGATCACCTCACCGTGTCCGGAGATGTCACGTTTGGGAAGAATGTGGTACTGAAGGGTACTGTGATTATAATTGCAAACCACGGAGATAGAATCGACATACCTCCCGGGGCAGTATTAGAAAACAAGATTGTGTCTGGAAACCTGCGGATCCTGGATCACTGA
Full Trace Sequence: ccaagcgctacccgggggcaataactacaaaatagtgtccgatccgctcaagtctgcaccgttctccaactttctcccctgctggaggctatctggaatctgctgcctgctctcggccatagctgccaaactggtgtcaccctagaagcgactcccttgccatagtggcgctgagccttggggtgacccagtaatatagtagcttctcgcacagctcataggaaaacatgacttcctttccgggaggattaaggaacgcaatggcgggtggaggcatgttacagttccaggaggccatccgagaggagctggaagaagccatgaagtcagacttggaaaaaattctttccacggcccctgaatcagaattagagcacataaagaaagaccttgctggttttcagaaattattccacagatttctacaggaaaaaggtccatcagtggactggggaaagatccagagacctccagaggattctattcagccatacgagaagataaaggcaaaaggccttccagataacatagcttcggtcctgaacaagctggttgtggtaaagcttaatggcggtttgggtacaagcatgggctgcaaaggtcccaaaagcctgattggcgttcgtaatgagaatactttcctagatcttactgtgaagcaaatagagcacttgaatacagtatacaacacagatgttccccttgtcctgatgaactctttcaacacagatgaagataccaagaagatcctacagaagtacagtcactgtcgagtgaagattcatacttttaatcagagcaggtacccaaggataagtaaggagtcactattgcccattgccaaagacttgtcctattctgtggaaaatgctgagacgtggtacccccctggtcatggtgatatctatgccagcttttataattccggcctcctagacaggctcataggggaagggaaggagtacatctttgtttccaacattgacaatcttggggccacagtggacctatatatccttaatcatctcatgaatccaccaaatggcaagaaatgtgaatttgtcatggaggtgactgacaaaacgagggctgatgtcaagggtgggaccctcactcagtgcgaagggaaactgaggctggtggaaattgcccaagtgccaagagcccatgtagatgagtttaaatctgtctccaagtttaagatctttaacacaaataatttgtggatttccttatctgcaatcaagaggctgcaagaagccaatgccatagatatggaaatcattgttaatcccaagacgttggatggaggattaaatgttattcagctggagacggctgttggagcagctattaaaagttttgaaaattctttgggtatcaatgttcctcgaagccgtttccttcctgtcaagaccacgtcagaccttctgcttgtcatgtccaacctgtacagccttcatgccggctccctgaccatgagcgagaagcgtgagttccccaccgtcccactcaccaaactgggaagctccttcacaaaggtacaagactatttgaagagatttgaaagtattccggatatgctggaactggatcacctcaccgtgtccggagatgtcacgtttgggaagaatgtggtactgaagggtactgtgattataattgcaaaccacggagatagaatcgacatacctcccggggcagtattagaaaacaagattgtgtctggaaacctgcggatcctggatcactgagctcacaacattttttatggatcatgtacagtataggcaagcgttccatacagggattgctggcacgtagatctctagtttgtaatcccgactcccgctgtacctcacagtattctcctatgtgtgcgatagtctttatttaattacagaatgataaagcccttgttatttggaagcaatacctaaacacatagtatatacagaaatctattcatgtgcaagaaaacttcaagtgcaatattgtcctctactgtgaagtaaataaaaggacaaacagaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MTSFPGGLRNAMAGGGMLQFQEAIREELEEAMKSDLEKILSTAPESELEHIKKDLAGFQKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKAKGLPDNIASVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVKQIEHLNTVYNTDVPLVLMNSFNTDEDTKKILQKYSHCRVKIHTFNQSRYPRISKESLLPIAKDLSYSVENAETWYPPGHGDIYASFYNSGLLDRLIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKKCEFVMEVTDKTRADVKGGTLTQCEGKLRLVEIAQVPRAHVDEFKSVSKFKIFNTNNLWISLSAIKRLQEANAIDMEIIVNPKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLHAGSLTMSEKREFPTVPLTKLGSSFTKVQDYLKRFESIPDMLELDHLTVSGDVTFGKNVVLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH
Donor tissue: tailbud