ORFeome > upk3a – XORFeome 2.0

upk3a – XORFeome 2.0

General Information

Species: Xenopus tropicalis uroplakin 3A, mRNA (cDNA clone MGC:75921 IMAGE:5383716), complete cds
Gene Symbol: upk3a
Gene ID: 394575
ORF gb_acc: MG132988
ORF ID: 10369

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC061365

Library Location

Plate ID: GDExt11004
Well Location: C05

EST Sequences

Clone: MGC:75921 IMAGE:5383716
Trimmed Sequence: ATGCCGTTGCTGGCCAACTCGGATTTCTTTAGCCTCAATCCCACCCAGACTACGATTGCGCTGGAGCAGCCGATCTGCATGTTTAAATCGGCCGTTAACGTCTATCTAATCGGGATCGTGGCAGGTGCCCCAAACACCCCGCTTTATGACGGCAATAAGAAGGTTAATGCCTCAACCTACAGCGGAACCCAGGGGGGCAAGACGGGACCCTATATCGTGGCCAAACTTCCCAACCAACAATGTATCAACATACAGGCCCTGAGCAATATGGCCGACCCCACGCAGGTGCAGTCCATCCTTAGCAAATACGTCGTGAGAGTGGGGGCCGACGTGACCTGCTTAACCAATCCCAACTTTGTGGGGTACTGCAACGCCCCCCTGCAGGGGAACACTCAATACAGTTTCAAGTATCTGTTTACAGACAGTGGGGATATTGTGCAGTCCGAGACCAGCTGGTCCCTGGGCATCACTACCGTCAATGGCAAAGCTTCTAGTACCATAGACACCTGGCCGGGCAGGAGGAGTGGTGGCATGATTGTCCTGACCTCCATTCTCAGCACTCTGATGTTCTTCGTTTTCATTGCCTACGTCATTGGCTTTGCTTACTCCATAGCGAACGGATCTCCTGCCAAGGAGGTGAGCAGACACGATACCCAGACCACTGCCGTCCTACAGAAAGCTCAGGAACCCGGAGAGGTCACGTATTCCTCAGCACTTACCGGCTCGGAGCGCTATGCGCCTACCCAACAGGCCTGA
Full Trace Sequence: cctgacgttggtcctagaggttcagccgcagagagatgggtccttggcgctatttgattggcctgtgctgtttcctacaggcgcctctggccggagcagacatgccgttgctggccaactcggatttctttagcctcaatcccacccagactacgattgcgctggagcagccgatctgcatgtttaaatcggccgttaacgtctatctaatcgggatcgtggcaggtgccccaaacaccccgctttatgacggcaataagaaggttaatgcctcaacctacagcggaacccaggggggcaagacgggaccctatatcgtggccaaacttcccaaccaacaatgtatcaacatacaggccctgagcaatatggccgaccccacgcaggtgcagtccatccttagcaaatacgtcgtgagagtgggggccgacgtgacctgcttaaccaatcccaactttgtggggtactgcaacgcccccctgcaggggaacactcaatacagtttcaagtatctgtttacagacagtggggatattgtgcagtccgagaccagctggtccctgggcatcactaccgtcaatggcaaagcttctagtaccatagacacctggccgggcaggaggagtggtggcatgattgtcctgacctccattctcagcactctgatgttcttcgttttcattgcctacgtcattggctttgcttactccatagcgaacggatctcctgccaaggaggtgagcagacacgatacccagaccactgccgtcctacagaaagctcaggaacccggagaggtcacgtattcctcagcacttaccggctcggagcgctatgcgcctacccaacaggcctgagctgctgttcctaatcggttctaatggaaatagctgaggtcttgatcatttaacgggccaatgaggttagggcagatcgtaggaacgttgcgcatcccatgatgctccatagactgtgtaggaacatcggccaatcccacaatcgttcacaatcagtctaaacccccaagctgtgattatttttgtttgctttttttaattgtatagaataacattttattcgacgcatttatatcgataataaaaggcgcattttggaacacgtgttgagcttctatggaaatccattgggggttcctacagttggactgtttgtgccgtttgcacggatatggctttgtatggggaaactttccaaataaatatttgttgttgttttttgtaacacacagaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MPLLANSDFFSLNPTQTTIALEQPICMFKSAVNVYLIGIVAGAPNTPLYDGNKKVNASTYSGTQGGKTGPYIVAKLPNQQCINIQALSNMADPTQVQSILSKYVVRVGADVTCLTNPNFVGYCNAPLQGNTQYSFKYLFTDSGDIVQSETSWSLGITTVNGKASSTIDTWPGRRSGGMIVLTSILSTLMFFVFIAYVIGFAYSIANGSPAKEVSRHDTQTTAVLQKAQEPGEVTYSSALTGSERYAPTQQA
Donor tissue: neurula