ORFeome > uqcrfs1 – XORFeome 2.0

uqcrfs1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1, mRNA (cDNA clone MGC:76317 IMAGE:5380232), complete cds
Gene Symbol: uqcrfs1
Gene ID: 394506
ORF gb_acc: MG132892
ORF ID: 10256

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC059770

Library Location

Plate ID: GDExt11003
Well Location: H01

EST Sequences

Clone: MGC:76317 IMAGE:5380232
Trimmed Sequence: ATGTTGTCCCTGGCGACTCGGTCCGGTTCTGTGGCACCTTACTTGTCGGCTACATCATATGCCGTGGCCGGGCAGCTTAAACCCCTGGTGTCCGGAGTGGTGCTCCAGGCGGATAAGGTTCTGCTGGATGTGAAGAAGCCTTTTCTATGCAGAGAGTCCTTGAATGGCCAGGCTCCTAACGGCGGCCTCTCCGCTTCGGCAGGAATTAATGGTGCCGCCTGTGTCCGCTTCCTTCATAGTGATGTAACTGTGCCGGACTTCTCAGATTATCGCAGGCCAGAAGTCTTGGACAGTACAAAATCATCTCAAACCAGCAGTGACTCCAGGAAAAGCTTCTCCTATTTAGTCACTGGAGTTACAGCAGTGGCCACAGCTTATGCTGCAAAAAATGCAGTTACTCAATTTGTCACAAGTATGAGTGCATCGGCTGATGTGCTGGCTATGTCCAAGATTGAAATAAAGTTGTCTGACATACCAGAAGGCAAGAATATGGCATTCAAGTGGAGAGGAAAACCACTCTTTGTGCGTCACAGAACCGCTAAAGAAATTGATCAAGAAGCTCAGGTCAACCTAACTGATCTAAGGGACCCACAACATGACCTTGACAGGGTGAAGAAGCCAGAGTGGGTCATTTTGATTGGTGTGTGCACTCACCTTGGTTGTGTGCCCATTGCCAATGCTGGGGAATTTGGTGGTTATTATTGCCCTTGTCATGGGTCCCATTATGATGCATCTGGTAGGATTCGCAAGGGTCCTGCTCCATTGAATCTTGAAGTTCCAGAGTATGAGTTTCCTTCTGATGATTTAGTAATTGTCGGATAG
Full Trace Sequence: ccggcgttaagttttcagctgtgcctgtagccatgttgtccctggcgactcggtccggttctgtggcaccttacttgtcggctacatcatatgccgtggccgggcagcttaaacccctggtgtccggagtggtgctccaggcggataaggttctgctggatgtgaagaagccttttctatgcagagagtccttgaatggccaggctcctaacggcggcctctccgcttcggcaggaattaatggtgccgcctgtgtccgcttccttcatagtgatgtaactgtgccggacttctcagattatcgcaggccagaagtcttggacagtacaaaatcatctcaaaccagcagtgactccaggaaaagcttctcctatttagtcactggagttacagcagtggccacagcttatgctgcaaaaaatgcagttactcaatttgtcacaagtatgagtgcatcggctgatgtgctggctatgtccaagattgaaataaagttgtctgacataccagaaggcaagaatatggcattcaagtggagaggaaaaccactctttgtgcgtcacagaaccgctaaagaaattgatcaagaagctcaggtcaacctaactgatctaagggacccacaacatgaccttgacagggtgaagaagccagagtgggtcattttgattggtgtgtgcactcaccttggttgtgtgcccattgccaatgctggggaatttggtggttattattgcccttgtcatgggtcccattatgatgcatctggtaggattcgcaagggtcctgctccattgaatcttgaagttccagagtatgagtttccttctgatgatttagtaattgtcggatagacacttgactcctaaaacaagtaatcactttctggaactgttaagcataagtgtcattaccttaactttcaagcaaggtgcattcagtttaatatgcttttaacatcacttatgtgttaaacattttaataaaccttaaaacttcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MLSLATRSGSVAPYLSATSYAVAGQLKPLVSGVVLQADKVLLDVKKPFLCRESLNGQAPNGGLSASAGINGAACVRFLHSDVTVPDFSDYRRPEVLDSTKSSQTSSDSRKSFSYLVTGVTAVATAYAAKNAVTQFVTSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTAKEIDQEAQVNLTDLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPEYEFPSDDLVIVG
Donor tissue: tadpole