ORFeome > wdr16 – XORFeome 2.0

wdr16 – XORFeome 2.0

General Information

Species: Xenopus tropicalis WD repeat-containing protein 69, mRNA (cDNA clone MGC:76247 IMAGE:5378990), complete cds
Gene Symbol: wdr16
Gene ID: 394975
ORF gb_acc: MG132870
ORF ID: 10229

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064252

Library Location

Plate ID: GDExt11002
Well Location: A11

EST Sequences

Clone: MGC:76247 IMAGE:5378990
Trimmed Sequence: ATGCGGCTAAAGCGATTCCTTCTCAGGTATTTCCCTCCAGGAATTATTTTAGAGTATGAAAAAGGAGGAGAACTGAAAACCAAGGCTATTGATTTACTGGAACTCTCCCCTACGACAGATGTGGATTTGGTAGTAGAAGAAATCCAGAAAGCTGAGCCACTTATCACTGCCTCCCGCACCCAACAAGTAAAACAGCTCATCCTGAGGCTGCAAGAAAAGATTGGTCAACAAGATAGCCGCCAGTTCTACCTATTCAAGGTTCTACGAGCTCACATCTTACCGCTCACAAATGTGGCTTTTAATAAGTCTGGCTCAAGTTTCATCACAGGGAGCTATGACCGGACATGCAAAGTATGGGACACTGCGTCGGGAGAAGAACTACATACATTAGAGGGCCATCGCAATGTGGTCTATGCCATACAGTTTAATAACCCCTATGGAGATAAAATTGCTACTGGATCCTTTGATAAAACATGCAAGTTGTGGAGCGCGGAGACAGGAAAATGTTATCATACTTTTCGAGGACACACTGCAGAAATTGTTTGCTTGGCTTTCAATCCTCAAAGCACCCTTATAGCAACTGGCAGCATGGACACCACTGCCAAGCTTTGGGACATTCAGAGTGGAGAGGAAGCCCTGACTTTAAGTGGACATGCTGCAGAAATTATCTCATTATCATTTAATACAACAGGAGACCGGCTGATCACAGGCTCCTTTGATCACACAGTGTCTGTCTGGGAGATTCCTTCTGGCAGGAGGATTCACACACTCATTGGTCATCGGGGTGAGATCAGCAGCGCACAGTTCAACTGGGACTGCTCCCTGATTGCAACTGCCTCTATGGATAAATCTTGCAAGCTTTGGGATTCTCTAAATGGTAAATGTGTTGCTACCCTGACTGGGCACGAGGATGAGGTACTGGATGTCACGTTTGATTCAACTGGGCAGTTGGTAGCCACTGCCTCAGCAGATGGAACTGCCAGAGTTTACAGTGCATCTAGCAGGAAATGCCTGGCAAAGCTTGAGGGACATGAAGGAGAGATTTCTAAGATTTGCTTCAATGCTCAGGGGAATCGCATATTAACGGCTAGCTCTGATAAGACCTCGCGGCTCTGGAACCCACACACAGGGGAATGCCTCCAGGTTCTCAAGGGACACACTGATGAAATCTTCTCATGTGCCTTTAACTATGAAGGCAACACTATCATTACAGGGAGCAAGGACAACACTTGCAGAATATGGCGTTAA
Full Trace Sequence: gagagagacacgatgcggctaaagcgattccttctcaggtatttccctccaggaattattttagagtatgaaaaaggaggagaactgaaaaccaaggctattgatttactggaactctcccctacgacagatgtggatttggtagtagaagaaatccagaaagctgagccacttatcactgcctcccgcacccaacaagtaaaacagctcatcctgaggctgcaagaaaagattggtcaacaagatagccgccagttctacctattcaaggttctacgagctcacatcttaccgctcacaaatgtggcttttaataagtctggctcaagtttcatcacagggagctatgaccggacatgcaaagtatgggacactgcgtcgggagaagaactacatacattagagggccatcgcaatgtggtctatgccatacagtttaataacccctatggagataaaattgctactggatcctttgataaaacatgcaagttgtggagcgcggagacaggaaaatgttatcatacttttcgaggacacactgcagaaattgtttgcttggctttcaatcctcaaagcacccttatagcaactggcagcatggacaccactgccaagctttgggacattcagagtggagaggaagccctgactttaagtggacatgctgcagaaattatctcattatcatttaatacaacaggagaccggctgatcacaggctcctttgatcacacagtgtctgtctgggagattccttctggcaggaggattcacacactcattggtcatcggggtgagatcagcagcgcacagttcaactgggactgctccctgattgcaactgcctctatggataaatcttgcaagctttgggattctctaaatggtaaatgtgttgctaccctgactgggcacgaggatgaggtactggatgtcacgtttgattcaactgggcagttggtagccactgcctcagcagatggaactgccagagtttacagtgcatctagcaggaaatgcctggcaaagcttgagggacatgaaggagagatttctaagatttgcttcaatgctcaggggaatcgcatattaacggctagctctgataagacctcgcggctctggaacccacacacaggggaatgcctccaggttctcaagggacacactgatgaaatcttctcatgtgcctttaactatgaaggcaacactatcattacagggagcaaggacaacacttgcagaatatggcgttaaaatggatccctcttataaagaaagtctctacggagtcagaacagccaaaatgcaatggacataagcaacatgcaatccctcaaattccttatatgaagtcataatatgagtcatttcagtcatttgtaaattgcacccaggactgctgacagtgtgtttgttttctttgtttccatttttatgtagatgtaataaactttttaataaaaacaaataggaaagttggaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MRLKRFLLRYFPPGIILEYEKGGELKTKAIDLLELSPTTDVDLVVEEIQKAEPLITASRTQQVKQLILRLQEKIGQQDSRQFYLFKVLRAHILPLTNVAFNKSGSSFITGSYDRTCKVWDTASGEELHTLEGHRNVVYAIQFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLAFNPQSTLIATGSMDTTAKLWDIQSGEEALTLSGHAAEIISLSFNTTGDRLITGSFDHTVSVWEIPSGRRIHTLIGHRGEISSAQFNWDCSLIATASMDKSCKLWDSLNGKCVATLTGHEDEVLDVTFDSTGQLVATASADGTARVYSASSRKCLAKLEGHEGEISKICFNAQGNRILTASSDKTSRLWNPHTGECLQVLKGHTDEIFSCAFNYEGNTIITGSKDNTCRIWR
Donor tissue: tailbud