ORFeome > wdr61 – XORFeome 2.0

wdr61 – XORFeome 2.0

General Information

Species: Xenopus tropicalis WD repeat domain 61, mRNA (cDNA clone MGC:75826 IMAGE:5382477), complete cds
Gene Symbol: wdr61
Gene ID: 394466
ORF gb_acc: MG133046
ORF ID: 10447

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC059759

Library Location

Plate ID: GDExt11004
Well Location: F10

EST Sequences

Clone: MGC:75826 IMAGE:5382477
Trimmed Sequence: ATGAGTACACAGTACAGCATTCTTTTCAAGCAGGAACATGCCCATGAAGATGCAATATGGTCAGTAGGATGGGGGAAAAACTCAAATGATGGGTCAGAGCTGGTGATCAGTGGTTCCCTGGATGATTTGGTCAAGGTGTGGAAATGGTCTGATGAACGGTTGGAGCTACAGTCTACACTGGAAGGCCATCAGCTAGGTGTGGTGTCAGTGGATGTCAGCCCTAGTGGGAACATAATGGCTTCCAGTTCCTTAGATGCTCACATTCGCCTGTGGGATCTTGAGAGTGGGAAGCAGATCCGCGCCATTGATGCAGGACCAGTGGATGCTTGGTCTGTAGCTTTTTCTCCTGACTCCCAACACCTTGCAACTGGAAGCCATGTGGGAAAAGTAAACATCTTTGGTGTGGAGACAGGGAAGAAGGAATATTCACTGGATACAAGAGGGAAATTTATCCTCAGCATTGCATATAGCCCAGATGGGAAATACTTAGCTAGCGGAGCCATTGATGGAATCATAAACATATTTGATATTGCTACAGGGAAACTCCTCCACACGTTGGAAGGACACGCCATGCCTATTAGATCCCTGACTTTCTCCCCTGATTCCCAGCTGCTGGTTACTGCATCAGATGATGGATATATCAAGATTTATGAAGTACAACATGCCAGTTTGGCTGCCACCTTGAGTGGGCATGGCTCCTGGGTGCTGAATGTGGCATTCTCTCCAGATGATACTCATTTTGTTTCCAGCTCTTCTGATAAAAGTGTAAAGGTCTGGGATGTATCTGCCAGAACATGTGTGCACACCTTCCTAGATCACCAAGACCAGGTTTGGGGCGTAAAATACAACAAGAATGGATCCAAAATTGTCTCTGTCGCCGATGATCAGGAAATTCACGTGTATGATTGTCCTATTTGA
Full Trace Sequence: atcaaagcgcgacttctatggccgcggggaaacttggagactagaaacagcaacgaggattgtatgaaagctaagaaaaacaacagcggagttcctggattatttctcactgtgagctgcgaatatgagtacacagtacagcattcttttcaagcaggaacatgcccatgaagatgcaatatggtcagtaggatgggggaaaaactcaaatgatgggtcagagctggtgatcagtggttccctggatgatttggtcaaggtgtggaaatggtctgatgaacggttggagctacagtctacactggaaggccatcagctaggtgtggtgtcagtggatgtcagccctagtgggaacataatggcttccagttccttagatgctcacattcgcctgtgggatcttgagagtgggaagcagatccgcgccattgatgcaggaccagtggatgcttggtctgtagctttttctcctgactcccaacaccttgcaactggaagccatgtgggaaaagtaaacatctttggtgtggagacagggaagaaggaatattcactggatacaagagggaaatttatcctcagcattgcatatagcccagatgggaaatacttagctagcggagccattgatggaatcataaacatatttgatattgctacagggaaactcctccacacgttggaaggacacgccatgcctattagatccctgactttctcccctgattcccagctgctggttactgcatcagatgatggatatatcaagatttatgaagtacaacatgccagtttggctgccaccttgagtgggcatggctcctgggtgctgaatgtggcattctctccagatgatactcattttgtttccagctcttctgataaaagtgtaaaggtctgggatgtatctgccagaacatgtgtgcacaccttcctagatcaccaagaccaggtttggggcgtaaaatacaacaagaatggatccaaaattgtctctgtcgccgatgatcaggaaattcacgtgtatgattgtcctatttgatactcgtgctccaaaggaggagatttgcgcacacactttcctctttaagagacacttttacttatcaaactgtatgttgctgttaagcaacaggtgccctcataagcaagttatgtcatttttctttgcacctttaaagtgttacagctatgcttgtgtaaatataatttctgcattaaagcagaatatatcactaacaatttgaccatagtttatccaaataaatctggatttaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSTQYSILFKQEHAHEDAIWSVGWGKNSNDGSELVISGSLDDLVKVWKWSDERLELQSTLEGHQLGVVSVDVSPSGNIMASSSLDAHIRLWDLESGKQIRAIDAGPVDAWSVAFSPDSQHLATGSHVGKVNIFGVETGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYEVQHASLAATLSGHGSWVLNVAFSPDDTHFVSSSSDKSVKVWDVSARTCVHTFLDHQDQVWGVKYNKNGSKIVSVADDQEIHVYDCPI
Donor tissue: neurula