ORFeome > ywhaz – XORFeome 2.0

ywhaz – XORFeome 2.0

General Information

Species: Xenopus tropicalis tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide, mRNA (cDNA clone MGC:75570 IMAGE:5379086), complete cds
Gene Symbol: ywhaz
Gene ID: 394780
ORF gb_acc: MG132769
ORF ID: 10079

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC063188

Library Location

Plate ID: GDExt11002
Well Location: G05

EST Sequences

Clone: MGC:75570 IMAGE:5379086
Trimmed Sequence: ATGGATAAAAACGAACTGGTTCAGAAGGCCAAGTTGGCTGAACAGGCAGAGCGGTACGATGACATGGCTGCTTGTATGAAGAGAGTTACCGAGGAGGGAGGGGAACTGTCCAATGAAGAAAGGAACCTTCTCTCAGTGGCCTACAAAAATGTAGTAGGTGCGCGTCGGTCGTCCTGGCGGGTGGTGTCTAGTATTGAGCAGAAGACGGAAGGAGCTGAAAAGAAACAGGAGATGTCACGAGAATACAGGGAGAAGATTGAGGCTGAATTGCGAGAAATCTGCAATGACGTTCTGAATCTTCTGGACAAATTCTTGATTGCCAACGCATCACAACCGGAAAGCAAAGTTTTCTATTTGAAAATGAAGGGTGACTATTATCGTTACTTGGCTGAAGTAGCTTCTGGCGACGCAAAGGCAGATATCGTGGCCCAGTCACAGAAGGCATATCAAGATGCTTTTGACATCAGCAAAACTGAAATGCAACCAACACATCCTATCCGATTGGGTCTGGCCCTGAACTTCTCTGTGTTCTATTATGAGATCCTCAATTGTCCAGAGAAAGCGTGTTCTCTTGCAAAGGCCGCTTTTGATGAAGCCATTGCTGAGCTTGACACTTTGAGCGAAGAGTCCTACAAAGACAGCACATTAATAATGCAGTTACTGAGAGACAACTTAACATTGTGGACATCAGACACCCAAGGGGATGAAGCTGAACAAGGAGAAGGAGGGGAGAATTAA
Full Trace Sequence: cgacaagcgccacaagtacgagcgccccgagtacgagcaccccacccaccgtctccctcctgcctctgcgcgcacccgtagcttaagcgaggagttggggtggggaaataaggagacgcagagacccaaacgggcggttattatgccacccagtcagcggttgccatagcagcgcttgacgtcactctccgacccctgctcagcgattggaggaaaccccgtgcatcggttagagctttgagcgctcggaaggagaccggactctgctatcggcagtcagtcacacacggagaaagcgagacgtgcgctcgtccaagcccggggattcgactacttgccggcaacggttcgtgttccctgcagcctatcacagaataatagccatggataaaaacgaactggttcagaaggccaagttggctgaacaggcagagcggtacgatgacatggctgcttgtatgaagagagttaccgaggagggaggggaactgtccaatgaagaaaggaaccttctctcagtggcctacaaaaatgtagtaggtgcgcgtcggtcgtcctggcgggtggtgtctagtattgagcagaagacggaaggagctgaaaagaaacaggagatgtcacgagaatacagggagaagattgaggctgaattgcgagaaatctgcaatgacgttctgaatcttctggacaaattcttgattgccaacgcatcacaaccggaaagcaaagttttctatttgaaaatgaagggtgactattatcgttacttggctgaagtagcttctggcgacgcaaaggcagatatcgtggcccagtcacagaaggcatatcaagatgcttttgacatcagcaaaactgaaatgcaaccaacacatcctatccgattgggtctggccctgaacttctctgtgttctattatgagatcctcaattgtccagagaaagcgtgttctcttgcaaaggccgcttttgatgaagccattgctgagcttgacactttgagcgaagagtcctacaaagacagcacattaataatgcagttactgagagacaacttaacattgtggacatcagacacccaaggggatgaagctgaacaaggagaaggaggggagaattaatcagccttcctttttgtctgcctcataaaatttacacaatagaccattcgtcatccttactgtcccacaaataggttttgttttttttttttttaattttattttttgtttttgttttgtttacaattacggtttatgttacttctctttggacttctatatttcccatgtggcttttgtgtttaataatagggaatagagccagttaatatttgggggagatatatatatttttttttttctctcttaaggtggccaatctagggatgttgaatttttatacatgttttaagtgttttggcatagtacttctggtaaaatcatggaaacgaagggatcatctgcaggggtgtttaacccttccctcagctgttatggggctgcctatgctatagaggtgtagccctgtaagagctgcagcagctggatatccctgttagagctgtgggcacagactttgacattcctaaagcgcaatgggtgcaggaaacctgcctcatgttccgctaaagcttttataccctccaagtctctgcctattctttttactgaatgttctttgagaaggcaagtacctgtcccactagtagccatggaggaaggaccccggttaccattcccagttccctaaaccttctgcttttgtttcaagttgctactctccaccttatttgtatttaaatcgtttttcaaccacctaagatcaaaacaaaaaaagtacttgactcattaaacgctccgtgcttggtatccatatttccactctctatcaagcgccgcagaaaaggaaaacaaaacccttctatttaacttttagtttttatttttgtttttgatacttgcctaacatgcatgtggctgtaaaaaaataaataaataaataaaataatttaaaaacaaacaaaaaaaaaaaaaaaactagttaccaggggaataacttgagatgatggctagctttgtttaatgtcttacggaaaaatttcatgaacaatccaagcataattgttaaagaacatgtgtaataagttgatgtaagtggaataaaaattttatgaacggaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MDKNELVQKAKLAEQAERYDDMAACMKRVTEEGGELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQEMSREYREKIEAELREICNDVLNLLDKFLIANASQPESKVFYLKMKGDYYRYLAEVASGDAKADIVAQSQKAYQDAFDISKTEMQPTHPIRLGLALNFSVFYYEILNCPEKACSLAKAAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEQGEGGEN
Donor tissue: tailbud