ORFeome > zfand6 – XORFeome 2.0

zfand6 – XORFeome 2.0

General Information

Species: Xenopus tropicalis zinc finger, AN1-type domain 6, mRNA (cDNA clone MGC:75964 IMAGE:5384157), complete cds
Gene Symbol: zfand6
Gene ID: 394631
ORF gb_acc: MG133006
ORF ID: 10393

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC061391

Library Location

Plate ID: GDExt11004
Well Location: D05

EST Sequences

Clone: MGC:75964 IMAGE:5384157
Trimmed Sequence: ATGGCGCAAGAGACAAACCACAGCCAGGCACCACTACTATGCTCTACAGGTTGCGGCTTCTATGGTAATCCTCGAACAAATGGTCTCTGTTCTGTGTGCTATAAAGAGCATCTACAGAGGCAAAACAGCGGTGGGAGAAATAGTCCCCCAGTTGTGTCCGTAGGAAGTGGAGTGGAAGTGTCAACTCCACAGAATGCAGAGAGTTCACAGGCAGGTGGTGTGGCAGATCCTGTGGTTCCACAGACTACACAGGCCAGCTCATTGCCGCTCTTGGAAACTGGGTCATCATCTTCGCAAGCTGAAAATGCAGAAAGCAGAACTACAGATACAAAAGAAATACCAGCTGCAACATCAGACAGTGCACAGAACTCTTCGGAGGAGCAGGAACGCTCTCCTGAAAAAGCCAAGCTGAAAAAGAACCGTTGCTTTATGTGCCGTAAAAAGATTGGACTCACTGGGTTCGAATGTCGATGTGGAAATGTATTCTGCGGGACTCACCGTTACTCTGATGTGCACAGTTGCTCTTATGACTACAAAGCGGATGCAGCTGAGAAGATCAGGAAAGAAAATCCTGTTGTGGTCGGAGAAAAGATTCAGAAAATTTAA
Full Trace Sequence: ggaagtggtgattgacaccggcaggtatcgggccgtaggtgacgtgagagggcagccgaagtgggacagacagcctgggagagcgataaaaggaagggcacaagacagaaaaagaggcctcctcttcggttcccgttgcatggtgcatgattatggcgcaagagacaaaccacagccaggcaccactactatgctctacaggttgcggcttctatggtaatcctcgaacaaatggtctctgttctgtgtgctataaagagcatctacagaggcaaaacagcggtgggagaaatagtcccccagttgtgtccgtaggaagtggagtggaagtgtcaactccacagaatgcagagagttcacaggcaggtggtgtggcagatcctgtggttccacagactacacaggccagctcattgccgctcttggaaactgggtcatcatcttcgcaagctgaaaatgcagaaagcagaactacagatacaaaagaaataccagctgcaacatcagacagtgcacagaactcttcggaggagcaggaacgctctcctgaaaaagccaagctgaaaaagaaccgttgctttatgtgccgtaaaaagattggactcactgggttcgaatgtcgatgtggaaatgtattctgcgggactcaccgttactctgatgtgcacagttgctcttatgactacaaagcggatgcagctgagaagatcaggaaagaaaatcctgttgtggtcggagaaaagattcagaaaatttaagaagggctgaaagttctgtgttcctgatgaaacctgccttgtgctgcaggagatgggccttggtgggaaaatggaaaacacaaaaaaaaaaatttcaaaccaccttgtgtctttttgactctgcttccagggatacagctgtgctggcttcacctttttttcagttttagtttgaatttttcctttatttcatctttttcctgaatcttctgagtggaaagaaaaaggatacaaaaacggacttgagtaaactcttatgtatcttctgcaggttttcatccttttcagaccagttagattattttttagaggcacagaggatttaaagaaaggagttcacaatactgtttgacatttttgtgttttcaaacgacaagcagttacatgtaggtttattcttcagaggacagttatccttgtattacaaaacaataacacattgcaaggttctctgatgcccaagaaattaagccaataactccttaacccactgtatttatcctaaagtaaatggattgatattttattggaccaatttaattatgtatgtatgtgagttctagagaaatgctctccttggagagtttagctctaagaactctctgctctacaacattgtgtgattgtttggatgattaaagaaactcttactatataaacagtgatgcatttaaatgatgctgcctgattgttccccatcaggcagtgcatttctttgttcatttaataggtgctatttagccctgattggtttaagtctgcagtcctcggctagagatcagtttgttcatctgtaggctgggagatcgctctgtatactgaaagactgaggcatccatcttccagacttttccccctttttcttcagcctgagaatgttatcaactgactttttttttttaagtagagaaagaaatcagatgtgtgaatgttggtccctcaaggaaaggtttaatgtttatgtcaatcttattaaataaaagttaaaaatctagagtaaaaaaaaaaaaaaaaaaaaa
Translation: MAQETNHSQAPLLCSTGCGFYGNPRTNGLCSVCYKEHLQRQNSGGRNSPPVVSVGSGVEVSTPQNAESSQAGGVADPVVPQTTQASSLPLLETGSSSSQAENAESRTTDTKEIPAATSDSAQNSSEEQERSPEKAKLKKNRCFMCRKKIGLTGFECRCGNVFCGTHRYSDVHSCSYDYKADAAEKIRKENPVVVGEKIQKI
Donor tissue: neurula