ORFeome > zic3 – XORFeome 2.0

zic3 – XORFeome 2.0

General Information

Species: Xenopus tropicalis Zic family member 3 (odd-paired homolog), mRNA (cDNA clone MGC:79799 IMAGE:6986356), complete cds
Gene Symbol: zic3
Gene ID: 448197
ORF gb_acc: MG133769
ORF ID: 11339

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC075118

Library Location

Plate ID: GDExt11014
Well Location: D01

EST Sequences

Clone: MGC:79799 IMAGE:6986356
Trimmed Sequence: ATGACAATGCTATTAGATGGAGGACCGCAATTTCCCACCCTGGGAGTTGGTGGGTTTGGGACAGCTCGCCATCATGAAATGTCCAACCGAGATGCTGGCATGGGGCTTAATCCATTTACTGAGCCTTCTCATGCTGCGGCTTTTAAGCTCAGTCCAGCCAGTCATGATCTCTCCTCAAGCCAGAGCTCGGCTTTTACCCCACAGGCTTCTGGATATGCCAATTCACTTGGACATCATGCTGGGCAGGTGCCATCTTACGGCGGTGCAGCTTTTAACTCCACACGCGATTTCCTTTTTCGAAATCGGAACTCTGGAATTGCGGACTCAACCTCTGCAGGTGGTCAACATGGACTTTTTGCCAGCCATGGTCCCCCAGGAATTGGTGAGCCACCAGGACACCTTATCTTCCCCGGACTTCATGAGCAAAGTTCCAGCCACACATCATCCAACGGACATGTGGTCAATGGTCAAATGCATTTAGGACTCAGGGGAGATATTTTCGGACGTCCAGATCCTTACAGGGCAGTGCCCAGCCCAAGGACAGATCATTATGCTGCTGCCCAGTTCCATAATTATAATCACATGAATATGAGCATGAATGTAGCTGCTCACCACGGCCCCGGGGCTTTCTTTAGATACATGAGGCAACCCATCAAACAAGAGTTATCGTGTAAGTGGCTTGAGGAATCACCAATGAACCGTCCTCAGAAAACCTGTGACAGGACATTTAGCAGCATGCATGAACTGGTTACACATATGACAATGGAACATGTTGGGGGTCCAGAACAAACTAATCACATATGCTACTGGGAGGAATGTCCCAGGGGTGGTAAATCCTTTAAAGCAAAGTATAAACTAGTGAATCATATCAGGGTGCATACAGGAGAAAAACCCTTTCCATGCCCCTTCCCTGGATGTGGGAAAATCTTTGCACGTTCAGAAAATCTCAAGATCCACAAAAGAACTCATACAGGTGAGAAGCCATTCAAGTGTGAGTTTGAGGGATGCGATAGAAGGTTTGCAAACAGCAGTGACAGGAAAAAACATATGCATGTGCACACTTCAGATAAGCCCTATATCTGCAAAGTGTGTGATAAATCCTACACTCACCCCAGCTCCCTAAGAAAACACATGAAGGTTCATGAATCACAAGGGTCTGATTCTTCTCCTGCTGCCAGCTCAGGGTATGAATCTGCCACCCCACCAGCAATGGTTTCTGCCAACAGTGAGGAACCTTCCAAAAATTCTTCAGCAACACATCAGACTAACAACAGCTCTCATAACACAGGACTACTTCCACCTAATTTTAACGAATGGTACGTCTGA
Full Trace Sequence: gtccaaggacattactcagttggagagggtgaacggtttccaggattttcggaagcaaaaggaattaaaagagaacttttttttttaaacattccacatgaactgtatccagtgctgaccacagaacagaactgcactgctcagctcattcatgacaatgctattagatggaggaccgcaatttcccaccctgggagttggtgggtttgggacagctcgccatcatgaaatgtccaaccgagatgctggcatggggcttaatccatttactgagccttctcatgctgcggcttttaagctcagtccagccagtcatgatctctcctcaagccagagctcggcttttaccccacaggcttctggatatgccaattcacttggacatcatgctgggcaggtgccatcttacggcggtgcagcttttaactccacacgcgatttcctttttcgaaatcggaactctggaattgcggactcaacctctgcaggtggtcaacatggactttttgccagccatggtcccccaggaattggtgagccaccaggacaccttatcttccccggacttcatgagcaaagttccagccacacatcatccaacggacatgtggtcaatggtcaaatgcatttaggactcaggggagatattttcggacgtccagatccttacagggcagtgcccagcccaaggacagatcattatgctgctgcccagttccataattataatcacatgaatatgagcatgaatgtagctgctcaccacggccccggggctttctttagatacatgaggcaacccatcaaacaagagttatcgtgtaagtggcttgaggaatcaccaatgaaccgtcctcagaaaacctgtgacaggacatttagcagcatgcatgaactggttacacatatgacaatggaacatgttgggggtccagaacaaactaatcacatatgctactgggaggaatgtcccaggggtggtaaatcctttaaagcaaagtataaactagtgaatcatatcagggtgcatacaggagaaaaaccctttccatgccccttccctggatgtgggaaaatctttgcacgttcagaaaatctcaagatccacaaaagaactcatacaggtgagaagccattcaagtgtgagtttgagggatgcgatagaaggtttgcaaacagcagtgacaggaaaaaacatatgcatgtgcacacttcagataagccctatatctgcaaagtgtgtgataaatcctacactcaccccagctccctaagaaaacacatgaaggttcatgaatcacaagggtctgattcttctcctgctgccagctcagggtatgaatctgccaccccaccagcaatggtttctgccaacagtgaggaaccttccaaaaattcttcagcaacacatcagactaacaacagctctcataacacaggactacttccacctaattttaacgaatggtacgtctgagcaaaatgtacagaggcctagtcatgctcaacaaaaggaccatgtgcaaaaaaagagaacccaatttttttgttgaatcgaggcggaaatggaatttaccacacaagcaacagtatagggcttcatcttgttaaaatcatttaccaacattctttaaagatggctgcggactaatgatgcccttttctcaggatctaaacacattatttggcgtttgtatttcttctgattttatgttctccccttttcattttaaccacttcacttcaaaaaaaaaaaagaaaaagaaattaagaggtctttagctaatgtattaaacatgaaaattctcttcaccttagtggtgattgttaaactctcacattcttaaacagtgccaaagtcttgttatgtcttgaacctaactcaaagcattacacttgtgaatgtattccttgtcttatagggtcaaagctgttgtgtggtatattttcagaaatggggatgtggtgttcatacacagattgtgaccgtttagtacagttgccttttgtaagaacttttgtaaatacatatccacgatgccatatttatcatttgtaatttaattattgatacaagtgccgggaactgaacaatatttatgaaaaaaaggtttttctaacaaaactctgtatagcttttggttataactgctttagcattaaaatttattgttttgaagaattcccatataaactgtctaacaaatgttttgtttacatcatgcaacactgaaactaacggaaatgttccgattctgctgtattaattggtcatcgaaaacaatattttttccagcttgtttgggcaatacttgtagatatatgaaatatttaagataagatcctatttattttgaagaataaagtataactgaagtaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MTMLLDGGPQFPTLGVGGFGTARHHEMSNRDAGMGLNPFTEPSHAAAFKLSPASHDLSSSQSSAFTPQASGYANSLGHHAGQVPSYGGAAFNSTRDFLFRNRNSGIADSTSAGGQHGLFASHGPPGIGEPPGHLIFPGLHEQSSSHTSSNGHVVNGQMHLGLRGDIFGRPDPYRAVPSPRTDHYAAAQFHNYNHMNMSMNVAAHHGPGAFFRYMRQPIKQELSCKWLEESPMNRPQKTCDRTFSSMHELVTHMTMEHVGGPEQTNHICYWEECPRGGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCGKIFARSENLKIHKRTHTGEKPFKCEFEGCDRRFANSSDRKKHMHVHTSDKPYICKVCDKSYTHPSSLRKHMKVHESQGSDSSPAASSGYESATPPAMVSANSEEPSKNSSATHQTNNSSHNTGLLPPNFNEWYV
Donor tissue: gastrula