ORFeome > znf207 – XORFeome 2.0

znf207 – XORFeome 2.0

General Information

Species: Xenopus tropicalis zinc finger protein 207, mRNA (cDNA clone MGC:75627 IMAGE:5379396), complete cds
Gene Symbol: znf207
Gene ID: 395007
ORF gb_acc: MG132876
ORF ID: 10237

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064165

Library Location

Plate ID: GDExt11002
Well Location: G07

EST Sequences

Clone: MGC:75627 IMAGE:5379396
Trimmed Sequence: ATGGGAAGAAAGAAGAAGAAGCAGCTCAAGCCGTGGTGTTGGTACTGCAACAGAGACTTTGATGATGAGAAAATTCTCATTCAGCACCAAAAGGCAAAACATTTTAAATGTCACATCTGTCACAAGAAGCTTTACACGGGGCCAGGCTTAGCCATCCATTGTATGCAGGTGCACAAGGAGACCATCGATGCTGTGCCCAACGCCATCCCTGGAAGGACTGACATTGAGCTGGAAATATACGGCATGGAGGGGATTCCTGAGAAGGACATGGAGGAAAGGAGGCGAATACTGGAACAAAAGACGCAGGTGGATAGCCAGAAGAAGAAAACCAACCAGGATGATTCTGATTATGACGACGATGACGACACCGCACCCTCCACTTCATTTCAACAGATGCAGGCACAGCAGGGATTCATGCCCACAATGGGACAGCCCGGCATACCTGGCCTACCTGGCGCCCCCGGAATGCCCCCAGGCATTCCACCTCTAATGCCAGCCGTGCCCCCCCTCATCCCTGGGATTCCGCCTGTCATGGCAGGGATGCACCCACATGGGATGATGCCAATGGGTGGGATGATGCACCCACATGGGCCTGGTATGCACCCTATGATGGCCGGATTGCCTCCAGGTGTGCCGCCCCCAGTTGGGCCTCGGCCAGGCATCCCTCCTGTGACACAAGCGCAGCCTGCATCGTCTCCAGCTGTTGTCAGTAGATTACCTGCCCCTAACACTTCTGCCCCTGCCCTGCAGACTGTCCCCAAACCCCTCTTCCCCAGTGCAGGACAGGCTCAGGCAACTGTTGCTGGACCTGTGGGAACGGATTTCAAACCCTTGAACACTATCCCTGCTACCAGTGCGGAACCTCCTAAACCAACATTCCCTGCTTACACCCAGTCTACTCTGGCAACCACTAGCACAACCAATAGCACTGCTTCTAAAGTGTCCACTTCCATAACAAGTAAGCCTGCTACCCTGACAACGACTAGTGCCACTAGTAAGTTGGTGCACCCAGATGAGGATATATCGCTGGAGGAGAAGCGTGCTCAGCTTCCAAAATATCAACGTAACCTACCCAGGCCTGGCCAGGGTCCCATGGGTAATCTGGGTGCTACAGCTGTTGGGCCTTTGGGAGCCATGATGGCTCCTCAGCCTGGGCTACTTACCCAGCAGCCTGGAATGAGGCATCCATTGCCACCCCATGGTCAGTATGGTGCGCCACATCAAGGAATGGCCGGCTATCATCCTGGTGCAATGCCTCCCTATGGACAAGGACCCCCCATGGTACCACCCTATCAAGGTGGGCCCCCTAGGCCTCTCATGGGGATAAGACCTCCTGTAATGTCTCAAGGTGGCCGCTACTGA
Full Trace Sequence: cagagagaggcggcagcgctgagccccggttggtacaatgggaagaaagaagaagaagcagctcaagccgtggtgttggtactgcaacagagactttgatgatgagaaaattctcattcagcaccaaaaggcaaaacattttaaatgtcacatctgtcacaagaagctttacacggggccaggcttagccatccattgtatgcaggtgcacaaggagaccatcgatgctgtgcccaacgccatccctggaaggactgacattgagctggaaatatacggcatggaggggattcctgagaaggacatggaggaaaggaggcgaatactggaacaaaagacgcaggtggatagccagaagaagaaaaccaaccaggatgattctgattatgacgacgatgacgacaccgcaccctccacttcatttcaacagatgcaggcacagcagggattcatgcccacaatgggacagcccggcatacctggcctacctggcgcccccggaatgcccccaggcattccacctctaatgccagccgtgccccccctcatccctgggattccgcctgtcatggcagggatgcacccacatgggatgatgccaatgggtgggatgatgcacccacatgggcctggtatgcaccctatgatggccggattgcctccaggtgtgccgcccccagttgggcctcggccaggcatccctcctgtgacacaagcgcagcctgcatcgtctccagctgttgtcagtagattacctgcccctaacacttctgcccctgccctgcagactgtccccaaacccctcttccccagtgcaggacaggctcaggcaactgttgctggacctgtgggaacggatttcaaacccttgaacactatccctgctaccagtgcggaacctcctaaaccaacattccctgcttacacccagtctactctggcaaccactagcacaaccaatagcactgcttctaaagtgtccacttccataacaagtaagcctgctaccctgacaacgactagtgccactagtaagttggtgcacccagatgaggatatatcgctggaggagaagcgtgctcagcttccaaaatatcaacgtaacctacccaggcctggccagggtcccatgggtaatctgggtgctacagctgttgggcctttgggagccatgatggctcctcagcctgggctacttacccagcagcctggaatgaggcatccattgccaccccatggtcagtatggtgcgccacatcaaggaatggccggctatcatcctggtgcaatgcctccctatggacaaggaccccccatggtaccaccctatcaaggtgggccccctaggcctctcatggggataagacctcctgtaatgtctcaaggtggccgctactgatgtttctgcactagtaaataggtttggagattaaaccttttctcatcttgtgctgtgtatatagccaagcttccgtcacttagagcttcactgtgactaaaacgtgtcccctacatacccggaacttttggacattttgttttacttgtgggtgggttatttttatttgtgggcaggagtttgtgggaaataaaccaggaatattcctgagattgcaatttatactgtatggcttctttttcatatttcatctaggtttttagaagtggcgtatagtaaatatggttcgtttaaatgtgaaggcgccaaataccaccttaaaggcaagttctgtaatgttattttgctctctgtatagtgatgccttcacagcaccctagggtgctgttggactttggtccccaacagtggttggtgagggctgtatctgttgcacctatttaggtctctgacaccccagccgctagggttcctacaatttgtgtgtcatgttaagaacttcattgtgtaataaaacaagcgaaaccttaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MGRKKKKQLKPWCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIPGRTDIELEIYGMEGIPEKDMEERRRILEQKTQVDSQKKKTNQDDSDYDDDDDTAPSTSFQQMQAQQGFMPTMGQPGIPGLPGAPGMPPGIPPLMPAVPPLIPGIPPVMAGMHPHGMMPMGGMMHPHGPGMHPMMAGLPPGVPPPVGPRPGIPPVTQAQPASSPAVVSRLPAPNTSAPALQTVPKPLFPSAGQAQATVAGPVGTDFKPLNTIPATSAEPPKPTFPAYTQSTLATTSTTNSTASKVSTSITSKPATLTTTSATSKLVHPDEDISLEEKRAQLPKYQRNLPRPGQGPMGNLGATAVGPLGAMMAPQPGLLTQQPGMRHPLPPHGQYGAPHQGMAGYHPGAMPPYGQGPPMVPPYQGGPPRPLMGIRPPVMSQGGRY
Donor tissue: tailbud