ORFeome > b3gnt7 – XORFeome 2.0

b3gnt7 – XORFeome 2.0

General Information

Species: Xenopus tropicalis UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7, mRNA (cDNA clone MGC:76194 IMAGE:5335954), complete cds
Gene Symbol: b3gnt7
Gene ID: 407949
ORF gb_acc: MG133436
ORF ID: 10952

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC067324

Library Location

Plate ID: GDExt11009
Well Location: H11

EST Sequences

Clone: MGC:76194 IMAGE:5335954
Trimmed Sequence: ATGTCTCAGTGGAAGAAGAAAATCTTTAAAAGTGCCGCACTCTTTTTCTGTCTGGTGATCACTTTTACGTTTCTTCAGAATGGGACGTCTCCTGGACTGTTTACTCAGGACCAACAGAAAGATTCTGGGTCCCAGATGTTAAGCACTCAAAAAAGAGACACTTATCCTGTTCCAGATGGGTTCTGGGAAGCCAAAGCCAAACGTGATCTTACAGAAGCAACTCCTAAAACAGAATTGCAACCAACAGAGTGGGATATTCACTCTACTAACTGTTCTCCCAACTGGAATCTTACCAAAATGGAATGGTACCGATCATTGGAACCAAATTTTCAACAGTTCATTCTCTCTCGTCATTGCCGCTACTTTCCTATGATTATTAACAACCAAGAGAAATGCAGCGAGGATATTGAACTACTAATAGTTGTGAAGTCCATCATTACTCAGCATGACCGCAGACAAGTGATCCGTAAAACATGGGGTAAAGATAGAGAGATAGATGGTAAAAAGGTGAAGACACTATTTCTTCTGGGAACCGCCATGAAAGCAGAGGAGAGAGCAAATTACCAGAAACTACTAGAGTTTGAAAATATAATATATGGTGACATTCTACAGTGGGACTTTTTAGATTCCTTCTTTAATCTGACCCTAAAAGAGGTACATTTTCTAAAGTGGATGGACATCTACTGCAAGAATGTGAAATACATCTTTAAGGGGGATGATGATGTTTTCGTAAGCCCTAATAACATCTTGGAGTTTCTCGATGGCAAGAATAACCCTAACCTGTTTGTAGGTGATGTTTTGCAGAAAGCTCGTCCTATACGTAGAAAGGACAACAAATATTACATCCCTACCGCTTTGTATAATAAAACGTTCTACCCTCCATATGCAGGTGGTGGAGGTTTTCTAATGGCAGGTTCTTTGGTCAGGAAGTTGCGCAAAGCATCTGAAACACTGGAACTGTATCCCATTGATGATGTTTTCTTAGGGATGTGTTTGGAAGTTATTAAGGTCTACCCTATCCATCATGAAGGATTTAAGACTTTTGGTATTGTCAGGAACAAAAACAGCAACATGAACAAAGACCCATGTTTTTTTAAAAATATGCTGGTTGTACACAAACTTCTTCCAGATGAGTTGGGGCGTATGTGGAAACTTGTCCAGGGTAACTTAACCTGTACACGGAAATTCAACATTCTTTAG
Full Trace Sequence: agccacaagctcactccttcagtggtcagcatgtctcagtggaagaagaaaatctttaaaagtgccgcactctttttctgtctggtgatcacttttacgtttcttcagaatgggacgtctcctggactgtttactcaggaccaacagaaagattctgggtcccagatgttaagcactcaaaaaagagacacttatcctgttccagatgggttctgggaagccaaagccaaacgtgatcttacagaagcaactcctaaaacagaattgcaaccaacagagtgggatattcactctactaactgttctcccaactggaatcttaccaaaatggaatggtaccgatcattggaaccaaattttcaacagttcattctctctcgtcattgccgctactttcctatgattattaacaaccaagagaaatgcagcgaggatattgaactactaatagttgtgaagtccatcattactcagcatgaccgcagacaagtgatccgtaaaacatggggtaaagatagagagatagatggtaaaaaggtgaagacactatttcttctgggaaccgccatgaaagcagaggagagagcaaattaccagaaactactagagtttgaaaatataatatatggtgacattctacagtgggactttttagattccttctttaatctgaccctaaaagaggtacattttctaaagtggatggacatctactgcaagaatgtgaaatacatctttaagggggatgatgatgttttcgtaagccctaataacatcttggagtttctcgatggcaagaataaccctaacctgtttgtaggtgatgttttgcagaaagctcgtcctatacgtagaaaggacaacaaatattacatccctaccgctttgtataataaaacgttctaccctccatatgcaggtggtggaggttttctaatggcaggttctttggtcaggaagttgcgcaaagcatctgaaacactggaactgtatcccattgatgatgttttcttagggatgtgtttggaagttattaaggtctaccctatccatcatgaaggatttaagacttttggtattgtcaggaacaaaaacagcaacatgaacaaagacccatgtttttttaaaaatatgctggttgtacacaaacttcttccagatgagttggggcgtatgtggaaacttgtccagggtaacttaacctgtacacggaaattcaacattctttagtattgatgcactgtatactgaagtggacaaaactgtaactgtactgtaatgttctctccctggcaggtttagggaagttttttttttttttatataatatattttatgggatcaatgatctcttatgtcaaggaattccaaagggcactgtccgaggtctgagatgaatggttaaaagaattatcacaataaatgagaccttgcttttagacttggtgtttcaggtttgcaggggttgtgtgtaatgaatttggaaccacctttgcagaaagccctattctaatattaacagagatactccgagatgcagtcttctcatctcgaaagcaagctccacactggacaaatctccgctttggagttatgcaacaaatcaaaggagcttggagcagaaacgcaggaatccggaaaagtgttggcagttgactgttggttttgatttaggccacacagaagatgacagtgacttgaatccaataagtttacagtaatccaagacctcaaaaccaaagtcaagccagtgaaactttatttgatcatatgactttacccttcgtttgttctgaagtgttgctcatagaagtgtattaatttataaaaaaattaagatttaaattaaattaacagggtaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSQWKKKIFKSAALFFCLVITFTFLQNGTSPGLFTQDQQKDSGSQMLSTQKRDTYPVPDGFWEAKAKRDLTEATPKTELQPTEWDIHSTNCSPNWNLTKMEWYRSLEPNFQQFILSRHCRYFPMIINNQEKCSEDIELLIVVKSIITQHDRRQVIRKTWGKDREIDGKKVKTLFLLGTAMKAEERANYQKLLEFENIIYGDILQWDFLDSFFNLTLKEVHFLKWMDIYCKNVKYIFKGDDDVFVSPNNILEFLDGKNNPNLFVGDVLQKARPIRRKDNKYYIPTALYNKTFYPPYAGGGGFLMAGSLVRKLRKASETLELYPIDDVFLGMCLEVIKVYPIHHEGFKTFGIVRNKNSNMNKDPCFFKNMLVVHKLLPDELGRMWKLVQGNLTCTRKFNIL
Donor tissue: tailbud