ORFeome > actc1 – XORFeome 2.0

actc1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis actin, alpha, cardiac muscle 1, mRNA (cDNA clone MGC:75679 IMAGE:5380133), complete cds
Gene Symbol: actc1
Gene ID: 394698
ORF gb_acc: MG132859
ORF ID: 10213

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC062494

Library Location

Plate ID: GDExt11002
Well Location: F07

EST Sequences

Clone: MGC:75679 IMAGE:5380133
Trimmed Sequence: ATGTGTGACGACGAGGAGACTACCGCCTTGGTGTGCGACAATGGCTCCGGGCTGGTGAAGGCTGGGTTCGCTGGGGATGATGCCCCACGTGCTGTGTTCCCCTCCATCGTTGGTCGCCCCCGTCACCAGGGTGTCATGGTGGGTATGGGTCAGAAAGACTCCTACGTAGGTGATGAAGCTCAGAGCAAGAGAGGTATCCTGACCCTGAAGTACCCCATTGAACACGGTATCATCACCAACTGGGATGATATGGAGAAGATCTGGCACCACACCTTCTACAATGAGCTGCGTGTGGCCCCTGAGGAGCACCCCACCCTGCTCACTGAGGCCCCACTGAACCCCAAGGCCAACCGTGAAAAGATGACACAGATCATGTTTGAGACCTTCAACGTCCCAGCCATGTATGTTGCCATCCAGGCTGTGCTGTCCCTGTACGCTTCTGGTCGTACCACAGGTATCGTTCTTGACTCCGGTGATGGTGTCACCCACAATGTCCCCATCTATGAAGGTTATGCCCTGCCCCATGCCATCATGCGTCTGGACCTGGCTGGTAGAGACCTCACAGATTACCTCATGAAAATCCTGACTGAACGTGGCTACTCTTTTGTCACCACAGCTGAACGTGAAATTGTCCGTGACATCAAGGAAAAGCTGTGCTATGTGGCTTTGGACTTTGAGAATGAAATGGCCACCGCTGCCTCTTCCTCCTCCCTGGAGAAGAGCTATGAGCTTCCCGACGGTCAGGTCATCACCATTGGAAATGAACGTTTCCGCTGCCCTGAGACCCTCTTCCAGCCTTCCTTCATTGGTATGGAATCTGCTGGTATCCATGAAACTACCTACAACAGCATCATGAAATGCGACATTGATATCCGCAAGGACCTGTACGCCAACAATGTCCTCTCTGGTGGTACCACCATGTACCCTGGTATTGCTGACAGAATGCAGAAGGAAATCACTGCCTTGGCTCCCAGCACCATGAAGATCAAGATCATTGCCCCACCTGAGCGTAAATACTCAGTCTGGATCGGTGGCTCCATCTTGGCCTCCCTGTCCACCTTCCAACAGATGTGGATCAGCAAACAGGAATACGATGAGGCAGGCCCCTCCATTGTGCACAGGAAGTGCTTCTAA
Full Trace Sequence: ttaatcacagcaaccagctctcctgtgctgaccagaacctaacctgccactatgtgtgacgacgaggagactaccgccttggtgtgcgacaatggctccgggctggtgaaggctgggttcgctggggatgatgccccacgtgctgtgttcccctccatcgttggtcgcccccgtcaccagggtgtcatggtgggtatgggtcagaaagactcctacgtaggtgatgaagctcagagcaagagaggtatcctgaccctgaagtaccccattgaacacggtatcatcaccaactgggatgatatggagaagatctggcaccacaccttctacaatgagctgcgtgtggcccctgaggagcaccccaccctgctcactgaggccccactgaaccccaaggccaaccgtgaaaagatgacacagatcatgtttgagaccttcaacgtcccagccatgtatgttgccatccaggctgtgctgtccctgtacgcttctggtcgtaccacaggtatcgttcttgactccggtgatggtgtcacccacaatgtccccatctatgaaggttatgccctgccccatgccatcatgcgtctggacctggctggtagagacctcacagattacctcatgaaaatcctgactgaacgtggctactcttttgtcaccacagctgaacgtgaaattgtccgtgacatcaaggaaaagctgtgctatgtggctttggactttgagaatgaaatggccaccgctgcctcttcctcctccctggagaagagctatgagcttcccgacggtcaggtcatcaccattggaaatgaacgtttccgctgccctgagaccctcttccagccttccttcattggtatggaatctgctggtatccatgaaactacctacaacagcatcatgaaatgcgacattgatatccgcaaggacctgtacgccaacaatgtcctctctggtggtaccaccatgtaccctggtattgctgacagaatgcagaaggaaatcactgccttggctcccagcaccatgaagatcaagatcattgccccacctgagcgtaaatactcagtctggatcggtggctccatcttggcctccctgtccaccttccaacagatgtggatcagcaaacaggaatacgatgaggcaggcccctccattgtgcacaggaagtgcttctaaacattacgcacactcctccaagcaacacatacaaagtacctcaaagtcgaagaaaacaagacctggacagtcactgtacagtttgtttacactccatcatatttattactttctaaataaaacacaagcggttacgttaaaaaaaaaaaaaaaaaaaaaa
Translation: MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF
Donor tissue: tadpole