ORFeome > actr3 – XORFeome 2.0

actr3 – XORFeome 2.0

General Information

Species: Xenopus tropicalis ARP3 actin-related protein 3 homolog, mRNA (cDNA clone MGC:76155 IMAGE:5335317), complete cds
Gene Symbol: actr3
Gene ID: 394999
ORF gb_acc: MG132718
ORF ID: 10012

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064225

Library Location

Plate ID: GDExt11001
Well Location: A04

EST Sequences

Clone: MGC:76155 IMAGE:5335317
Trimmed Sequence: ATGGCGGCTCGGCTCCCGGCTTGTGTGGTGGATTGTGGCACCGGGTACACCAAGCTCGGCTACGCGGGGAATACAGAGCCGCAATTCATCATCCCATCATGTATCGCTATCAAGGAGTCGGCCAAGGTGGGGGACCAGGCCCAGCGGCGCCTAATGAAAGGGGTGGATGATCTGGATTTCCACATTGGGGATGAAGCCATAGACAAGCCGACATACGCAACTAAGTGGCCCATTCGCCATGGGATTGTGGAGGATTGGGACCTCATGGAGAGATTCATGGAACAAATCATCTTCAAATATCTCCGAGCAGAACCTGAAGATCATTACTTCCTCCTGACGGAACCCCCCCTGAATACCCCAGAGAACAGGGAATACACTGCTGAAATCATGTTTGAGTCTTTCAACGTCCCAGGGCTGTACATTGCTGTTCAGGCTGTTCTGGCCCTGGCTGCATCCTGGACCTCTCGGCAGGTTGGAGAGCGTACGCTCACTGGCACGGTGATAGACAGCGGCGATGGAGTCACACACGTCATTCCTGTGGCTGAAGGTTACGTCATTGGAAGCTGCATTAAACACATTCCTATTGCTGGTCGGGACATTACCTACTTCATACAGCAGTTACTCCGGGACAGGGAAGTGGGAATTCCACCGGAGCAATCGCTGGAAACTGCCAAGGCTGTAAAGGAGCGGTTCAGCTACGTGTGCCCGGATTTAGTTAAGGAATTTAGCAAATACGATACAGACGGTGCCAAATGGATCAAACAGTACACGGGGGTGAATGCCGTTTCTAAGAAGGAATTCAGCATTGACGTTGGTTACGAGCGCTTTCTGGGGCCCGAAATCTTCTTTCATCCAGAGTTTGCCAATCCAGATTTCACCCAGCCCATATCGGAAGTGGTGGATGAAGTGATACAGAACTGCCCTATTGACGTTCGGCGCCCCCTGTACAAGAATATCGTACTCTCTGGGGGCTCCACTATGTTCCGCGACTTTGGCCGGCGCTTACAGAGGGATGTAAAGAGAACGGTCGATGCCCGGCTGAAGCTGAGTGAGGAGCTGAGTGGGGGTCGCCTTAAGCCCAAGCCCATTGACGTTCAGGTGATCACCCACCACATGCAGAGGTACGCTGTTTGGTTCGGGGGATCCATGCTGGCTTCCACGCCGGAGTTTTACCAAGTGTGCCACACCAAGAAGGACTATGAAGAGATTGGGCCGAGCATATGTCGCCACAACCCCGTGTTCGGTGTCATGTCCTAA
Full Trace Sequence: ttcgtaactcggacatggcggctcggctcccggcttgtgtggtggattgtggcaccgggtacaccaagctcggctacgcggggaatacagagccgcaattcatcatcccatcatgtatcgctatcaaggagtcggccaaggtgggggaccaggcccagcggcgcctaatgaaaggggtggatgatctggatttccacattggggatgaagccatagacaagccgacatacgcaactaagtggcccattcgccatgggattgtggaggattgggacctcatggagagattcatggaacaaatcatcttcaaatatctccgagcagaacctgaagatcattacttcctcctgacggaaccccccctgaataccccagagaacagggaatacactgctgaaatcatgtttgagtctttcaacgtcccagggctgtacattgctgttcaggctgttctggccctggctgcatcctggacctctcggcaggttggagagcgtacgctcactggcacggtgatagacagcggcgatggagtcacacacgtcattcctgtggctgaaggttacgtcattggaagctgcattaaacacattcctattgctggtcgggacattacctacttcatacagcagttactccgggacagggaagtgggaattccaccggagcaatcgctggaaactgccaaggctgtaaaggagcggttcagctacgtgtgcccggatttagttaaggaatttagcaaatacgatacagacggtgccaaatggatcaaacagtacacgggggtgaatgccgtttctaagaaggaattcagcattgacgttggttacgagcgctttctggggcccgaaatcttctttcatccagagtttgccaatccagatttcacccagcccatatcggaagtggtggatgaagtgatacagaactgccctattgacgttcggcgccccctgtacaagaatatcgtactctctgggggctccactatgttccgcgactttggccggcgcttacagagggatgtaaagagaacggtcgatgcccggctgaagctgagtgaggagctgagtgggggtcgccttaagcccaagcccattgacgttcaggtgatcacccaccacatgcagaggtacgctgtttggttcgggggatccatgctggcttccacgccggagttttaccaagtgtgccacaccaagaaggactatgaagagattgggccgagcatatgtcgccacaaccccgtgttcggtgtcatgtcctaatcccgcgtgtgctgggaggggccggtgtgcgtgtcgggacgttggggcgcccaggcttggaggagccccccaatttctctttgcacgggtggaacccagacagattcctttccatgaaatattgttgaataaaagaagcgagtggcttttagttgtctgtgccctggggttctgtctgcttctggcagctcctacagttatgggttgcgctggttctgtagaactcgtgcggtacagacgaaccgggccccaaatgctggacattgggatcagcttatgtgctcagtgggcaatgtggcccctgagagccccgagctcctcccccgctttgcctttctgccctgtctggatactgagcgcttttccctatagttctgtctgtgtcggttccgctcgctcttccgcttctgggtttttgtttttgttttgaatctgaaaatccaataataaacgatatcatgatgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAARLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRLMKGVDDLDFHIGDEAIDKPTYATKWPIRHGIVEDWDLMERFMEQIIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERFSYVCPDLVKEFSKYDTDGAKWIKQYTGVNAVSKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDVKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS
Donor tissue: tailbud