ORFeome > anxa11 – XORFeome 2.0

anxa11 – XORFeome 2.0

General Information

Species: Xenopus tropicalis annexin A11, mRNA (cDNA clone MGC:89007 IMAGE:7004411), complete cds
Gene Symbol: anxa11
Gene ID: 448260
ORF gb_acc: MG134154
ORF ID: 11784

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC075326

Library Location

Plate ID: GDExt11017
Well Location: B10

EST Sequences

Clone: MGC:89007 IMAGE:7004411
Trimmed Sequence: ATGAGCTACCCAGGATACCCGGGTGGGTTTCCACCAGTGCCCACAGGTAGTAACCCATGGGGAGCTCCTGCTAACCCTCCTCCTATTGGGCTGGATAACATGTCAAACTTTTCTCAGCAATACAACCCCCAACAGTACATGACCTCAGGGTTCCCGCCAGCTGGGTTTGGAGGAATGGACCAACAACAGGGGATGTACCCTCAAGCTCCAGGTGGCTACCCAGCACCTCCAGGTGGATATGGAGCACCACCAATGCCTGGGCAACCTCAGGTTCCTTCCTATGGCATGTATCCTCCTCCAGGAGCAGGCCAACAGCCAGGAATGCCTGGGTATAACACAGGATACCCAGCGGCACCTCTGCCAGGCCAACCCATGCCAACACCTGGCCAGCCCCAAATGCCCATGCCTGGACAACCCCCAATGAACTATCCTGGACAGCAGCCTACACCAAGTTATCCTCAAGGCCCAGCAATGAATCCATCTTACCCATCTCCTGGGATGCCACCTTCAACAACCCCTACTGTCATACCTTCATATGGAAAGGTAACACGAGGAACCATCACAGATGCAGCAAACTTTGATGCATTGAGAGATGCTGAGGTGCTCAGGAAGGCCATGAAAGGCTTTGGAACTGACGAGCAGGCCATTATTGAATGCCTGGGGAGTAGGTCTAACAAACAAAGGCAACAGATCAGCCTCTCTTTTAAAACTGCTTATGGAAAGGATTTGATAAAAGATTTAAAGTCTGAGCTTTCTGGGAATTTTGAGAAGACAATCCTGGCAATGATGAAAACTCCAACTCTTTATGATGCGCATGAGATACATGAGGCAATTAAGGGAGCTGGCACAGATGAAGAATGTCTCATTGAGATCCTGGCTTCTAGGAGTAATGCTGCAGTACATGAAATCTGTAATGCATACAAAACAGAATATAAGAAAACTTTGGAACAAGCTATTAAAAGTGACACTTCTGGTCACTTCCTACGGCTGCTGGTTTCACTGGCTCAGGGAAATCGAGATGAAAGCAACAACGTAGACATGGCATTAGTCCAACGGGATGTGCAGGAGCTGTATGCTGCTGGAGAGAATCGTCTGGGGACAGACGAGTCCAAATTTAATGCCATCCTATGTACTCGAAGCAGAGCACACCTTAATGCAGTATTTTCTGAATACCAGCGAATGTGTAATCGAGACATTGAGAAAAGCATCTGTCGTGAGATGTCTGGGAACCTTGAAAATGGCATGTTGGCAGTGGTAAAATGCCTAAAAAATACTCCTGCCTTCTTCGCTGAGCGTCTCTACAAATCAATGAAGGGTGCTGGCACAAAGGACAAGACTCTGATCCGTATCATGGTGTCCCGTAGTGAGGTAGACTTGTTGGATATCCGTTCAGAATATAAAAGAATGTATGGAAGATCCCTTTACACAGATATCACGGGAGACACGTCTGGCGACTACAGGAAGATTCTGCTGAAACTCTGTGGGGGAAATGACTAA
Full Trace Sequence: cagagagacgcagtcaggagattgtcgcgtctaaaaaaggactatcaaatcccagttaaatgagctacccaggatacccgggtgggtttccaccagtgcccacaggtagtaacccatggggagctcctgctaaccctcctcctattgggctggataacatgtcaaacttttctcagcaatacaacccccaacagtacatgacctcagggttcccgccagctgggtttggaggaatggaccaacaacaggggatgtaccctcaagctccaggtggctacccagcacctccaggtggatatggagcaccaccaatgcctgggcaacctcaggttccttcctatggcatgtatcctcctccaggagcaggccaacagccaggaatgcctgggtataacacaggatacccagcggcacctctgccaggccaacccatgccaacacctggccagccccaaatgcccatgcctggacaacccccaatgaactatcctggacagcagcctacaccaagttatcctcaaggcccagcaatgaatccatcttacccatctcctgggatgccaccttcaacaacccctactgtcataccttcatatggaaaggtaacacgaggaaccatcacagatgcagcaaactttgatgcattgagagatgctgaggtgctcaggaaggccatgaaaggctttggaactgacgagcaggccattattgaatgcctggggagtaggtctaacaaacaaaggcaacagatcagcctctcttttaaaactgcttatggaaaggatttgataaaagatttaaagtctgagctttctgggaattttgagaagacaatcctggcaatgatgaaaactccaactctttatgatgcgcatgagatacatgaggcaattaagggagctggcacagatgaagaatgtctcattgagatcctggcttctaggagtaatgctgcagtacatgaaatctgtaatgcatacaaaacagaatataagaaaactttggaacaagctattaaaagtgacacttctggtcacttcctacggctgctggtttcactggctcagggaaatcgagatgaaagcaacaacgtagacatggcattagtccaacgggatgtgcaggagctgtatgctgctggagagaatcgtctggggacagacgagtccaaatttaatgccatcctatgtactcgaagcagagcacaccttaatgcagtattttctgaataccagcgaatgtgtaatcgagacattgagaaaagcatctgtcgtgagatgtctgggaaccttgaaaatggcatgttggcagtggtaaaatgcctaaaaaatactcctgccttcttcgctgagcgtctctacaaatcaatgaagggtgctggcacaaaggacaagactctgatccgtatcatggtgtcccgtagtgaggtagacttgttggatatccgttcagaatataaaagaatgtatggaagatccctttacacagatatcacgggagacacgtctggcgactacaggaagattctgctgaaactctgtgggggaaatgactaaatatttgttaactctcttttacaatccttgttcttttttgttttaactggggaatatcagtgggtgtattgacagtcagtcagaatttagatttttatgggcatacaactccattctgggctacagtataatcctatgcaatatcgctgtagctagtccagagtgtaaaataaagtggttgcaattctatttgcctaggggctcagaaactatgccagtaaattccactagatttttcatgtatgtgaacatacatgtacaactatgaagttggcaagcggtgatgtgatgtggcacccaatacatttacagggtgaggaatgggctgattagttgcatgaagtgaacttgttaagaaaagtggggtgccactgcaggaaacttcaggaaagagtaggaattacaaatttactgacaataacatttctggtaaatttttaatgtcaccgctgccctatcaggtgattttacaggctaggcctgtatgtaaagcactgctagtcagaaaccctagtagcatagtgtacaattctcatattatgtcaaacatggtgtcattttacaccacttttcatgccaactgttgctgaatttgtctcattgacttcagtgggttacatgaggtctagactagtgcaaagcaattgttattttataaaggcaattagctttttgtaatggattatttctgtaatccagatgcatgctgtttgttcacgtctaacaactgtgcttaataaatacaccatttgttttacacaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSYPGYPGGFPPVPTGSNPWGAPANPPPIGLDNMSNFSQQYNPQQYMTSGFPPAGFGGMDQQQGMYPQAPGGYPAPPGGYGAPPMPGQPQVPSYGMYPPPGAGQQPGMPGYNTGYPAAPLPGQPMPTPGQPQMPMPGQPPMNYPGQQPTPSYPQGPAMNPSYPSPGMPPSTTPTVIPSYGKVTRGTITDAANFDALRDAEVLRKAMKGFGTDEQAIIECLGSRSNKQRQQISLSFKTAYGKDLIKDLKSELSGNFEKTILAMMKTPTLYDAHEIHEAIKGAGTDEECLIEILASRSNAAVHEICNAYKTEYKKTLEQAIKSDTSGHFLRLLVSLAQGNRDESNNVDMALVQRDVQELYAAGENRLGTDESKFNAILCTRSRAHLNAVFSEYQRMCNRDIEKSICREMSGNLENGMLAVVKCLKNTPAFFAERLYKSMKGAGTKDKTLIRIMVSRSEVDLLDIRSEYKRMYGRSLYTDITGDTSGDYRKILLKLCGGND
Donor tissue: