ORFeome > anxa7 – XORFeome 2.0

anxa7 – XORFeome 2.0

General Information

Species: Xenopus tropicalis annexin A7, mRNA (cDNA clone MGC:79834 IMAGE:6987252), complete cds
Gene Symbol: anxa7
Gene ID: 407959
ORF gb_acc: MG133749
ORF ID: 11318

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC076713

Library Location

Plate ID: GDExt11013
Well Location: B04

EST Sequences

Clone: MGC:79834 IMAGE:6987252
Trimmed Sequence: ATGTCGTACCAATACCCTTCAGGCTTCCCAGGATATCCAGGCTATCCTGGAGGCGACCCATCATATCCACCAGGAGCACAACAGGCTTTTCCTGGGGGACAGTTCCCCCCTGCTGCAGGAGGAGGTGCATATCCACCAGCTTCTGGTGGGGGTTTTCCGTCTGCGCCTGGCGGAGGCTACCCTCCGGCAGGGGGATACCCAGCTCCTGGTGGCTTTCCTGGAGGCATGCCATCTTACCCTGGAGGGCCAGGCTTTGGAGCGCCTGCTGGTGGGCCAGGTTATGGTGCCCCTCCAGGTGCACCTGGTTATGGAGCCCCCAGCGGAGTCCCTGGGTATGGTGGGCCTGGTTTTAATGCGCCAGCTGGTGGATATGGGGCTCCTAATGCAGGGGGTTTTGGGGCACCCCCAGCTGGTGGATATGGAGCTCCTGGAGGTGCACCAGGCTATGCTGGTTTTGCACAACCTTCATCTCAAAGCTATGGAGCAGGAATGCCAGGTCAAATGCCAGGTCAAATGCCAGGTCAAATGCCAGGCCAAATGCCAGGTCAAATGCCAGGCCAAGCACCCGGTGGATATCCAAGTGGCCCAGCACCATCACAACCTGTGCCTTATGCAGCAGCAATGACAGCTACCCAGGGCACAATAAAAGCAGCACCTAACTTTGATGCCCTATCTGATGCTGAAAAGCTAAGAAAAGCAATGAAAGGATTTGGAACTGATGAGCAAGCCATCGTTGACGTTGTTGCTAACCGTTCCAATGACCAGAGACAAAAGATTAAGGCAGCATTTAAGACTGCTTATGGCAAAGATTTAATAAAAGATCTGAAGTCGGAACTAAGTGGAAATGTGGAAGAACTCATCATTGCACTTTTCATGCCTGCCACATATTATGATGCCTGGAGTTTATATCATGCCATGAAGGGGGCAGGAACACAAGAGCGAGTACTCATTGAGATTCTCTGCACGAGGACAAACAGTGAAATCAAGAACATTGTTTCCTGTTACAAACATGAGTTTGGCAGAGACATCGAGAAGGACATTCGATCAGACACTTCAGGCCATTTCGAAAGACTGCTGATATCCATGTGCCAGGGGAACCGTGATGAGAACCAAAATGTTAACCTGCAGCAGGCTGAGCAGGATGCCCAACGCCTTTACCAAGCAGGAGAAGGGAAGCTTGGCACAGATGAGTCCTCCTTCAATTTAGTGTTAGCAAGTCGAAGTTTCCCCCAGCTAAGAGCTGTGGCTGAAGCGTATGCTAGGATTTCTAAACGCGACTTGATTAGTGTCATTGGCAGAGAATTTTCTGGATATATAGAAGATGGCCTGAAAGCAGTTTTGCAGTGTGCTATCAACCGACCTGCTTTCTTTGCTGAAAGACTTTACCGCTCTATGAAGGGAGCCGGCACTGATGATTCCACTCTCATAAGGATTATTGTCACCAGAAGCGAGATTGATCTTGTGCAGATCAAACAGGCTTATGTACAGATGCACCAGAAATCTCTGTCTGCGGCAATCTCTAGTGATACATCTGGGGACTACAGGCGCCTGCTGATAGCAATTGCTGGCCAGTAG
Full Trace Sequence: ccccgcctttctcctcctgtctttcctgagggagatttaatttgcgagctccatcttgtcagcgccaggtctcggaagtctccttctcacagaactcctgcaagcatctgacaagaatgtcgtaccaatacccttcaggcttcccaggatatccaggctatcctggaggcgacccatcatatccaccaggagcacaacaggcttttcctgggggacagttcccccctgctgcaggaggaggtgcatatccaccagcttctggtgggggttttccgtctgcgcctggcggaggctaccctccggcagggggatacccagctcctggtggctttcctggaggcatgccatcttaccctggagggccaggctttggagcgcctgctggtgggccaggttatggtgcccctccaggtgcacctggttatggagcccccagcggagtccctgggtatggtgggcctggttttaatgcgccagctggtggatatggggctcctaatgcagggggttttggggcacccccagctggtggatatggagctcctggaggtgcaccaggctatgctggttttgcacaaccttcatctcaaagctatggagcaggaatgccaggtcaaatgccaggtcaaatgccaggtcaaatgccaggccaaatgccaggtcaaatgccaggccaagcacccggtggatatccaagtggcccagcaccatcacaacctgtgccttatgcagcagcaatgacagctacccagggcacaataaaagcagcacctaactttgatgccctatctgatgctgaaaagctaagaaaagcaatgaaaggatttggaactgatgagcaagccatcgttgacgttgttgctaaccgttccaatgaccagagacaaaagattaaggcagcatttaagactgcttatggcaaagatttaataaaagatctgaagtcggaactaagtggaaatgtggaagaactcatcattgcacttttcatgcctgccacatattatgatgcctggagtttatatcatgccatgaagggggcaggaacacaagagcgagtactcattgagattctctgcacgaggacaaacagtgaaatcaagaacattgtttcctgttacaaacatgagtttggcagagacatcgagaaggacattcgatcagacacttcaggccatttcgaaagactgctgatatccatgtgccaggggaaccgtgatgagaaccaaaatgttaacctgcagcaggctgagcaggatgcccaacgcctttaccaagcaggagaagggaagcttggcacagatgagtcctccttcaatttagtgttagcaagtcgaagtttcccccagctaagagctgtggctgaagcgtatgctaggatttctaaacgcgacttgattagtgtcattggcagagaattttctggatatatagaagatggcctgaaagcagttttgcagtgtgctatcaaccgacctgctttctttgctgaaagactttaccgctctatgaagggagccggcactgatgattccactctcataaggattattgtcaccagaagcgagattgatcttgtgcagatcaaacaggcttatgtacagatgcaccagaaatctctgtctgcggcaatctctagtgatacatctggggactacaggcgcctgctgatagcaattgctggccagtaggttttccctgccagtgaaatatatccgaaggattatatgtccatatatacatacatatatatagatgcaaagtataaactgcactgttacaggaactgatcatgaacgtgttcataccatcaatgtaaagtttgtcagttacagattttgtttatattttttacacacatgccttatatataaactatatagctggttttcccacttgaaccaaaaatatcaccataatatacccagtgcctttgttacatgacaaaaatctaaattgtataaaaaaaaacaaaaaacttaggtcagaaaggagttttcccatctttgcgatactctctacaatccttttgttcagtacagaaataattgcaaaaacgaaaagttctgcgtgaaacaaataatgcatctttaacttgctattgtttctcagctgacttcacgggatctgcttttaatcctaaagatctttcccatctgctattttgtaggcaagcaatgttgctctgcatagagaataatgaggcaatgtatgtgcacgtgacaaagggaccatcttgcagggataagcaaatgataactatggcagcatgaataaacgtgtaatggatttttacacaccagtgttttatgtcattttagtttttgtttagggtttctgttatttcccatctcacagctcctagcagctctctacaccctacgatagacagttggatcaggaagggagaaagaatggcacaatagtgatagttggggagagttatatattaactgggttttaggaagggcacaaacggaacagtaaagactataagacaatgtggtggcaccttaccaaggtcaggcaatatatgattgacagctgggacttttaaatgcttatataatgggtatagatgtggtaataaaaaaatgactttgagaaaaagctaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSYQYPSGFPGYPGYPGGDPSYPPGAQQAFPGGQFPPAAGGGAYPPASGGGFPSAPGGGYPPAGGYPAPGGFPGGMPSYPGGPGFGAPAGGPGYGAPPGAPGYGAPSGVPGYGGPGFNAPAGGYGAPNAGGFGAPPAGGYGAPGGAPGYAGFAQPSSQSYGAGMPGQMPGQMPGQMPGQMPGQMPGQAPGGYPSGPAPSQPVPYAAAMTATQGTIKAAPNFDALSDAEKLRKAMKGFGTDEQAIVDVVANRSNDQRQKIKAAFKTAYGKDLIKDLKSELSGNVEELIIALFMPATYYDAWSLYHAMKGAGTQERVLIEILCTRTNSEIKNIVSCYKHEFGRDIEKDIRSDTSGHFERLLISMCQGNRDENQNVNLQQAEQDAQRLYQAGEGKLGTDESSFNLVLASRSFPQLRAVAEAYARISKRDLISVIGREFSGYIEDGLKAVLQCAINRPAFFAERLYRSMKGAGTDDSTLIRIIVTRSEIDLVQIKQAYVQMHQKSLSAAISSDTSGDYRRLLIAIAGQ
Donor tissue: gastrula