ORFeome > arf3 – XORFeome 2.0

arf3 – XORFeome 2.0

General Information

Species: Xenopus tropicalis ADP-ribosylation factor 3, mRNA (cDNA clone MGC:79549 IMAGE:6978283), complete cds
Gene Symbol: arf3
Gene ID: 431681
ORF gb_acc: MG133648
ORF ID: 11198

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC080915

Library Location

Plate ID: GDExt11011
Well Location: G05

EST Sequences

Clone: MGC:79549 IMAGE:6978283
Trimmed Sequence: ATGGGGAACATCTTTGCCAATCTGTTTAAAGGTCTCTTTGGTAAGAAGGAGATGAGAATTCTTATGGTGGGCTTGGATGCAGCCGGTAAGACCACCATCCTGTACAAGCTAAAACTTGGCGAGATCGTGACCACCATCCCCACAATAGGTTTCAATGTGGAAACAGTAGAATACAAGAACATCAGTTTTACAGTGTGGGATGTGGGTGGTCAGGACAAAATTCGACCTTTGTGGCGTCATTATTTCCAGAACACTCAGGGTCTGATCTTTGTTGTGGATAGTAATGATAGAGAGAGAGTGAATGAAGCCAGAGAGGAGCTAACAAGAATGCTAGCAGAAGATGAGCTACGAGATGCAGTACTGTTAGTGTTTGCAAACAAGCAGGATCTTCCAAACGCTATGAATGCTGCTGAGATCACAGACAAACTAGGCCTGCATTCCCTTCGTCATCGGAACTGGTACATTCAGGCTACCTGTGCGACCAGTGGAGATGGGCTGTATGAGGGCTTGGACTGGCTCTCTAACCAGCTGAAGAATCAGAAGTGA
Full Trace Sequence: gcaaaggagaggcggcgggaggcgacggaggaacggtggatataaacacactacaatggggaacatctttgccaatctgtttaaaggtctctttggtaagaaggagatgagaattcttatggtgggcttggatgcagccggtaagaccaccatcctgtacaagctaaaacttggcgagatcgtgaccaccatccccacaataggtttcaatgtggaaacagtagaatacaagaacatcagttttacagtgtgggatgtgggtggtcaggacaaaattcgacctttgtggcgtcattatttccagaacactcagggtctgatctttgttgtggatagtaatgatagagagagagtgaatgaagccagagaggagctaacaagaatgctagcagaagatgagctacgagatgcagtactgttagtgtttgcaaacaagcaggatcttccaaacgctatgaatgctgctgagatcacagacaaactaggcctgcattcccttcgtcatcggaactggtacattcaggctacctgtgcgaccagtggagatgggctgtatgagggcttggactggctctctaaccagctgaagaatcagaagtgatcccttcccatataagtgccctccatccctatgcccctctctcccacccaactcccatcctgttcaacatcttggcagagctggccagcacctctgctgtctactgggcgggcatgtaatttctttcagcacacattaccgttgtgtgtgtgcttgcacgcctattttgagtgggagcagcaatctcacactgtgccttatacatgcttagcagtattaattctcctcacccacaataacactacccattcagccatgtcagcagttaccttcaacaccctttctgtgccgctacattcaatgctgttctgtctttaaacagcatctttgaattgattgtgtagtgccctttctgcctaactatatatttatgcttatttggtgttttatgctggaatgattaagtcatgtctgtggcagaaattctaaattcttaccagcttgcactaaagaatgctgtgaagcagccatgttttcattgctaacgatgcctgctttgttgttggtgtgcatccatcagtgcttggtataagggaactttcacagctgagggttttattatctgctgtaatgtcatatgtggcacggctataggtcaccctcaatacactgccattgaatgtatccattcatgcttttattcacctaactttattgtatcaacagtctcttatttcccatgaaaggctgttgcatgtttttaagcaaggttaagcattttggaaattacttttttgcattttacatggaaaaggtacagctgaagaatgggtgcagggtcttcataggcatggccacggtagtgatctttcagtctgttgctgcactacaactcccagcagacttattggcatgctggtatttgttaggtcagttacagttggagatccaaaggcattgtattgaactgaataagttgtggaaatggtgtttattatttcacttgctcagcgctagcatcacaggataaaacccagtgctgtttacatacttatatagatacacgcacacttccttcatactgacttgcatgtagtatcaccagcctgctcttgaaggcttctgagatgactgctcccactctttagaatattttattatttctgtaaggaatatccttgggtgctcttggatatcccctgtctggaaggaaatctgtacagtaatatggtaatctaattgactaatgttttattgcattatccttatccaaattatttcttggccccatcatagctttgttttcatcagaaggactgagatttggggaataaagaagcagcagggaggtgaggggtaaaaaggtgagagggaatttgtatgtgcacagtcactccagtaagtagttgaataataacctgactggtttgtgccattagaggcttgattgggggagagcgctaagtggatgcccaggttctgtactttggaccctctacaaaagctgattagccttccagagttctagggaacatccacaagcaatggaaagcgcaaggcgtacattactagtaacaagaatgtaggacaactcgataaatatataaatatataattttatatggaaaaaaaactggcaactgtttttgagagaaaacatagtttaaaaatatataaaatagggttgcaggaaaatgggttttggttaaaaggaaataatcagttaattgtttgatttggggaagatagcatttgaatccaaaataaagggttggacagggctaccattctattaagcagaacatgggagccagaataaaaacaggttagggcagagtttggcagcctacagcactccagagtgatcctgggagttgtagtcctataagcggctgcccatgccatcatcagagccatgtattactgtaaatgacctatcccctctctcagcatttggcttgctgtgaagtatcaccagcaaaatacactcaccaattacactgaggcttctgtcctttccttcataatcccccgcttccctcccacaaggccgccttctggaactaacgaacatttcaattaatgtgtttttaatatcactgtgggagagtgcttctattttgtgttacttcagtgtgcagcagaaggggggtaccatttcatttttaaactcaaaagatttgtagaccatttttgtggggacttgggaatgtagctcttaacaattttaaatatatatatacttcttaaaagtctgtaaatgagaccgttttcatatcttcatgcctaaaatgaatcaaagctttaaagctcaacttttatttcctgtataaactgattctcaagtgtgaagtacatgatgtacaattggacctaaatcttttttttttttttttctttgttttgttttctaaccatgttgtaatttgtctgaaatgctctaaaataaagagttctgtattgaaataaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLKNQK
Donor tissue: tailbud