ORFeome > arfrp1 – XORFeome 2.0

arfrp1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis ADP-ribosylation factor related protein 1, mRNA (cDNA clone MGC:75956 IMAGE:5384031), complete cds
Gene Symbol: arfrp1
Gene ID: 394772
ORF gb_acc: MG133012
ORF ID: 10399

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC063363

Library Location

Plate ID: GDExt11004
Well Location: B10

EST Sequences

Clone: MGC:75956 IMAGE:5384031
Trimmed Sequence: ATGTACACCCTGCTGTCCGGCCTGTACAAGTACATGTTCCAGAAGGACGAGTTCTGCATCCTCATCCTCGGCCTCGACAATGCCGGCAAAACCACCTTCCTGGAACAGACGAAAATCCAGTTCAGCCGTAACTACAAGGGAATGAACCTCTCCAAGATCACAACCACCGTCGGGCTGAACATTGGTACCATTGATGTGGGGAAGGTGCGGCTGATGTTCTGGGACCTGGGGGGGCAGGAGGAGCTGCAGGCACTGTGGGATAAGTATTATGCAGAGTCCCACGGGGTCATCTACGTCATTGATTCCACGGATGAAACTCGTCTCTCAGAATCCAAACTCGCCTTCGAGCGGATGATCAGCAGCGAGTCCTTGGAGGGGGTCCCTATCCTGGTTCTGGCTAACAAGCAGGATGTGGAGGGCTGTCTCTCTATCCCAGATATAAAGACTGCTTTCAGTGACTGCATTAACAAGATCGGTAAGAGGGACTGCCTGACCCAGGCCTGCTCGGCGCTCTCGGGGACGGGGCTGAACGAGGGGGTCGAATGGATGGTTAAATGCGTTGTGAGGAACATACACCGCCCCCCCCGGCAGAAAGACATCACATAG
Full Trace Sequence: gttcccttcccgtggtgcattgcgtgcggaaagtggagctgatgtggaattcaggtacccgccatgtacaccctgctgtccggcctgtacaagtacatgttccagaaggacgagttctgcatcctcatcctcggcctcgacaatgccggcaaaaccaccttcctggaacagacgaaaatccagttcagccgtaactacaagggaatgaacctctccaagatcacaaccaccgtcgggctgaacattggtaccattgatgtggggaaggtgcggctgatgttctgggacctgggggggcaggaggagctgcaggcactgtgggataagtattatgcagagtcccacggggtcatctacgtcattgattccacggatgaaactcgtctctcagaatccaaactcgccttcgagcggatgatcagcagcgagtccttggagggggtccctatcctggttctggctaacaagcaggatgtggagggctgtctctctatcccagatataaagactgctttcagtgactgcattaacaagatcggtaagagggactgcctgacccaggcctgctcggcgctctcggggacggggctgaacgagggggtcgaatggatggttaaatgcgttgtgaggaacatacaccgccccccccggcagaaagacatcacataggaccgtgccctgtgattggaggatggagctgtgcggggcggctgggtatgagggactgtaggggcatcggcgtgggcagtgcccgggtacaggctgattcctgtgtatagtttgtaaccatagcaaccaacgctgacagattgaatgcacagccaatgggatgtgggggggggggggtactccccagggcttagtttattcatctaaatgtgatgaaccaatcaggggccaactcccagcatccaatcccagtgggagggagtccgggcaccaccgaggggccacatgtaggttagtgccccactgatctgcccatttctgcccccccccccaacctgccttctccccgtgaccccatatccttttccccccccgtgccccccagccagcggtgggctcccacactctgcggaggggctcattctcaggaagtgatgattgggttcagcccccccccctgccttgtaccccagcgcctcccattatttattgatactccccctattccctgtataacccccccatgttacttcccagggtgcattgggctcagcgggcgtcatggtgtctgtgtgcctcatacaatgtgtcgttgtgaaaataaaatgttagtcacttcctatgctgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MYTLLSGLYKYMFQKDEFCILILGLDNAGKTTFLEQTKIQFSRNYKGMNLSKITTTVGLNIGTIDVGKVRLMFWDLGGQEELQALWDKYYAESHGVIYVIDSTDETRLSESKLAFERMISSESLEGVPILVLANKQDVEGCLSIPDIKTAFSDCINKIGKRDCLTQACSALSGTGLNEGVEWMVKCVVRNIHRPPRQKDIT
Donor tissue: neurula