ORFeome > armc8 – XORFeome 2.0

armc8 – XORFeome 2.0

General Information

Species: Xenopus tropicalis armadillo repeat containing 8, mRNA (cDNA clone MGC:97797 IMAGE:6990424), complete cds
Gene Symbol: armc8
Gene ID: 496954
ORF gb_acc: MG134506
ORF ID: 12219

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC088583

Library Location

Plate ID: GDExt11021
Well Location: D10

EST Sequences

Clone: MGC:97797 IMAGE:6990424
Trimmed Sequence: ATGGCGTGCGTGTTGGAGCCTCCGCTCCGGATGAGCGTGTTATCTGAGGTTACTGCGAGCAGTCGCCATTATGTTGACCGTCTCTTTGATCCAGATCCCCAAAAGGTCTTACAGGGAGTCATAGATATGAAAAATGCAGTTATTGGAAACAATAAACAGAAAGCAAACCTCATTGTTTTGGGTGCTGTACCAAGATTATTGTATTTGCTTCAACAAGAGACTTCAAGCACAGAGTTGAAGACTGAATGTGCAGTGGTTCTAGGCAGCCTGTCAATGGGCACAGAAAACAATGTTAAATCCCTGCTAGATTGTCACATTATTCCAGCCCTGCTTCAAGGTCTGCTGTCATCAGACCTACGATTTATTGAAGCCTGTCTTCGATGTCTACGTACAGTTTTCACTAGTCCAGTGACTCCTGTGGAACTTTTATACACTGATGCATCGGTTATTCCACACCTCATGTTGTTGCTCAGCAGATCAGTATACGCCCAGGAGTATATATGTCAGATTTTTGCTCACTGCTGCAAGGGGCCAGACCATCAGACAATATTATTTAATCATGGTGTGGTCCAGAATATCGCTCATCTATTAACATCAGTGTCCTACAAAGTACGTATGCAAGCATTAAAGTGCTTTTCAGTCCTAGCATTTGACAATCCCCAGGTGTCTATGACCCTTGCAAATGTACTGGTTGATGGAGAATTGTTGCCACAAATATTTGTGAAGATGCTACAAAGAGATAAGCCTATTGAAATGCAACTGACTGCTGCTAAATGTCTAACGTACATGTGTCGTGCAGGATCTATTCGAACTGATGATAACTGCATTGTGTTAAAAACACTTCCCTGCCTGGTACGTATGTGCAGCAAAGAGCGCCTTCTAGAGGTGCGAGTGGAAGGTGCTGAAACCCTTGCTTACCTGATCGAACCAGATGTTGAACTTCAGAGAATTGCCAGTATCACAGATCATCTGATCTCCATGCTTGCTGACTATTTCAAATACCCCAGCTCAGTCAGTGCCATCACTGATATCAAGAGGGTGTGTAAACTGTATCATCTTTTTGTATCCCTTAATATACCTAAATACTACCCCCAAATTTAG
Full Trace Sequence: ccaagatggcgtgcgtgttggagcctccgctccggatgagcgtgttatctgaggttactgcgagcagtcgccattatgttgaccgtctctttgatccagatccccaaaaggtcttacagggagtcatagatatgaaaaatgcagttattggaaacaataaacagaaagcaaacctcattgttttgggtgctgtaccaagattattgtatttgcttcaacaagagacttcaagcacagagttgaagactgaatgtgcagtggttctaggcagcctgtcaatgggcacagaaaacaatgttaaatccctgctagattgtcacattattccagccctgcttcaaggtctgctgtcatcagacctacgatttattgaagcctgtcttcgatgtctacgtacagttttcactagtccagtgactcctgtggaacttttatacactgatgcatcggttattccacacctcatgttgttgctcagcagatcagtatacgcccaggagtatatatgtcagatttttgctcactgctgcaaggggccagaccatcagacaatattatttaatcatggtgtggtccagaatatcgctcatctattaacatcagtgtcctacaaagtacgtatgcaagcattaaagtgcttttcagtcctagcatttgacaatccccaggtgtctatgacccttgcaaatgtactggttgatggagaattgttgccacaaatatttgtgaagatgctacaaagagataagcctattgaaatgcaactgactgctgctaaatgtctaacgtacatgtgtcgtgcaggatctattcgaactgatgataactgcattgtgttaaaaacacttccctgcctggtacgtatgtgcagcaaagagcgccttctagaggtgcgagtggaaggtgctgaaacccttgcttacctgatcgaaccagatgttgaacttcagagaattgccagtatcacagatcatctgatctccatgcttgctgactatttcaaataccccagctcagtcagtgccatcactgatatcaagagggtgtgtaaactgtatcatctttttgtatcccttaatatacctaaatactacccccaaatttagctttgttgagtctgttgtatatggtatgctagtttatgaatgctaatgcttacctttagatacaggaatatgacctgggcattttcttttatctgtgtaaaaaaatggtattctatggggcatatttattatgctgtgcaagacgaatttgccgaaaaaacggcataaaaagctgtgtaaaataaatggagaagatcaccatccgaacgccagattttacgtctttattttacgttagttctgccggaagaaaaaatgcgttaatcaatttagctgttttttgcatggcgaagcctggcgatatgtggcgaattttctctacatttttttacacagcataattaatatgcccttaagtgttttactctaatagtatcgttttgtaactagagccattcatgttctgtgtgtgatatgcatgtagttctgtgtatacatgcatgtatatgcatgtttttccctattaaagggaaactgtagatcatatcatgctaataattctgttgcacagaatagttctttctttgagatataaatagttttagtgttctacttagacctaagactttatcctactttaaacaactcaaccatgctttttgacagtagcgccattgcagatggcttactcaggcagcaagctagggtaggtgaaatatgtccaaaacatgaagaatgtttgtgttgcagcaggaaaaaaaggttaggtttaaagtggacctgtcacccagacataaaaagctttataataaaaacccaaaatgattttttcatgaccccatccatacccattataaaagcatttaaaaatcccagctgttaatcatatattgcctgtcccgcctctatgccttaggcatagaggtgaggcagagagttactttcactttcaattcagaaagaaacatctttttagatgttgctgctgtcttcacattccccctccctccgcaccatgtaattttgtaatcagtgcatggacatgggcatcaggtccccacccatactggcacagaaacaagattttggcaggatgcaatgcctgctttgataagtgtccacaaaatggtgctggcctgcttgctgcaattgtgaattccaaggctgaagaaaataagattaaaataatttatatagtgtaagtaaagtttattttgcttgacaaacacaatagaaaacaatttgaaattatttcttaaggtgacgggtcccctttaagaacacagaatatcaataaatctaattatttctacagaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MACVLEPPLRMSVLSEVTASSRHYVDRLFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLSMGTENNVKSLLDCHIIPALLQGLLSSDLRFIEACLRCLRTVFTSPVTPVELLYTDASVIPHLMLLLSRSVYAQEYICQIFAHCCKGPDHQTILFNHGVVQNIAHLLTSVSYKVRMQALKCFSVLAFDNPQVSMTLANVLVDGELLPQIFVKMLQRDKPIEMQLTAAKCLTYMCRAGSIRTDDNCIVLKTLPCLVRMCSKERLLEVRVEGAETLAYLIEPDVELQRIASITDHLISMLADYFKYPSSVSAITDIKRVCKLYHLFVSLNIPKYYPQI
Donor tissue: gastrula