ORFeome > atp1b2 – XORFeome 2.0

atp1b2 – XORFeome 2.0

General Information

Species: Xenopus tropicalis ATPase, Na+/K+ transporting, beta 2 polypeptide, mRNA (cDNA clone MGC:75733 IMAGE:5381183), complete cds
Gene Symbol: atp1b2
Gene ID: 394667
ORF gb_acc:
ORF ID: 10292

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061283

Library Location

Plate ID: GDExt11003
Well Location: D12

EST Sequences

Clone: MGC:75733 IMAGE:5381183
Trimmed Sequence: ATGGCGGCTATGAGTCAGAAGAGAAGCTGTGGGGAGATAATGAACGAATTTAAGGAATTTATGTGGAACCCAAGGACCCGGGAATTCATGGGCCGGACAGCGAGCAGTTGGGGTCTGATTGTCTCTTTCTACCTGGTTTTTTATGCCTTCCTTACGGGCATGTTTGCCCTCTCCATGTACGTCATGTTACAGACCATCGACGAATATACCCCCAAGTACTGGGACCGACTTACTAGCCCAGGACTGATGATTCGCCCCAAAACAGACACTCTGGAGATTGTTTATAGCATCAGCGGAAACTCCAGCTGGGCGCCCTACGTTTCCCAACTAAACTCAATGCTGGACCCATACAATGACACAGTGCAGATGCAACAGGGCTCTGTGTGCCCCAGCGGGGTGTTTAACAAACAGGACGATACGGGGGACGTGAGAAATTACCCCAAGAAGGCCTGTCAGTTCCTCCGGAGCTCCCTGGGCGACTGCTCGGGGCTAACAGACCCCACGTATGGCTACTCCACTGGCAGCCCCTGTCTCCTCATCAAGATGAACAAGATCATAAACTTCTACCCTGGCGTCATCCCAAGTCTCTCGAATACGTCCATCACCATAAACTGCACGGGCACGACGGCAAACATGGATCAGATGTTGGGGAGTCGCACTTATTACCCCAGTAGCAACCCCAGTAACGGCACCAGTAACGGCACCAGTCTGGGCACCATGGACCTCATGTATTTTCCATACTATGGGAACAGAGCACAGAAGAACTATTCGCAGCCGCTGGTGGCGGTGAAGTTCTACAACTTGACGCTGAACCAAGACCTGTACGTGCAGTGCCGCGCCAACGCCGTCAATATCAACACCAATGACAGTCAAGACAAGTTTTCGGGGCGCGTCTCATTCAAGCTGCACATCAATAAATGA
Full Trace Sequence: gagagacaccaagagactagcaggggaaacagccaattgccccaactctcacaccccacagtgctttaaagcctactgcaccagggcatttattgttggcaaggggcaataagcaagatggcggctatgagtcagaagagaagctgtggggagataatgaacgaatttaaggaatttatgtggaacccaaggacccgggaattcatgggccggacagcgagcagttggggtctgattgtctctttctacctggttttttatgccttccttacgggcatgtttgccctctccatgtacgtcatgttacagaccatcgacgaatatacccccaagtactgggaccgacttactagcccaggactgatgattcgccccaaaacagacactctggagattgtttatagcatcagcggaaactccagctgggcgccctacgtttcccaactaaactcaatgctggacccatacaatgacacagtgcagatgcaacagggctctgtgtgccccagcggggtgtttaacaaacaggacgatacgggggacgtgagaaattaccccaagaaggcctgtcagttcctccggagctccctgggcgactgctcggggctaacagaccccacgtatggctactccactggcagcccctgtctcctcatcaagatgaacaagatcataaacttctaccctggcgtcatcccaagtctctcgaatacgtccatcaccataaactgcacgggcacgacggcaaacatggatcagatgttggggagtcgcacttattaccccagtagcaaccccagtaacggcaccagtaacggcaccagtctgggcaccatggacctcatgtattttccatactatgggaacagagcacagaagaactattcgcagccgctggtggcggtgaagttctacaacttgacgctgaaccaagacctgtacgtgcagtgccgcgccaacgccgtcaatatcaacaccaatgacagtcaagacaagttttcggggcgcgtctcattcaagctgcacatcaataaatgaaagcaaatgaccaatccgtaatggcgtctcatggggccccaggggccccgccaagtcccatagcctggaacatatcccataatgccaggcaagggtgcctccctcaagtatcattcacagaccatcttctcagttgcctagcaaccgaaataaagcaaaagtaatggggcgtgggggggggttctgcaagaaatatgattttatttttaaattccgcatttctaaccaattgcattgtaaataagaaatatttaacccttcatgaatcctgtacagtccctttgggtgtaaatagaaccagttgtaacataccccctggtgcaacaataaagcgacaaacccaactgccaaaaaaaaaaaaaaaaaaaaaa
Translation: MAAMSQKRSCGEIMNEFKEFMWNPRTREFMGRTASSWGLIVSFYLVFYAFLTGMFALSMYVMLQTIDEYTPKYWDRLTSPGLMIRPKTDTLEIVYSISGNSSWAPYVSQLNSMLDPYNDTVQMQQGSVCPSGVFNKQDDTGDVRNYPKKACQFLRSSLGDCSGLTDPTYGYSTGSPCLLIKMNKIINFYPGVIPSLSNTSITINCTGTTANMDQMLGSRTYYPSSNPSNGTSNGTSLGTMDLMYFPYYGNRAQKNYSQPLVAVKFYNLTLNQDLYVQCRANAVNINTNDSQDKFSGRVSFKLHINK
Donor tissue: tadpole