ORFeome > atp1b3 – XORFeome 2.0

atp1b3 – XORFeome 2.0

General Information

Species: Xenopus tropicalis ATPase, Na+/K+ transporting, beta 3 polypeptide, mRNA (cDNA clone MGC:76183 IMAGE:5335793), complete cds
Gene Symbol: atp1b3
Gene ID: 394687
ORF gb_acc: MG132686
ORF ID: 9976

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC062517

Library Location

Plate ID: GDExt11001
Well Location: F03

EST Sequences

Clone: MGC:76183 IMAGE:5335793
Trimmed Sequence: ATGGCCAAGGAAGAGAACAAGGGAAGCGAGCAGTCTGGCTCCGACTGGAAGCAGTTCATCTACAACCCGCAGAGTGGAGAGTTCATGGGCCGCACGGCTAGTAGTTGGGCTCTGATCCTGCTATTCTACTTGGTGTTTTATGGATTCCTCGCTGGGCTCTTTACCCTTACCATGTGGGTCATGCTTCAAACACTGGATGATTCTGTCCCCAAATACCGAGACAGAGTTTCTTCTCCAGGTTTAATGATTTCTCCTAAATCTGCTGGGCTTGAGATTAAATTTACCCGGAATAAGACTCAGTCTTATCAGGAATATATCCAGACTCTTCATACATTCCTTACACCTTACAATGATGCCATCCAAGCCAAGAATGATCTTTGTGCCCCAGGCCTGTATTTTGATCAGGACGAAAAAGATGAAAAGAAGGCTTGCCAGTTCAACAGGTCTTCCCTCGGACTTTGCTCTGGGATAGAAGATAACACGTTTGGATACAACGAAGGCAAACCTTGCGTTATTGTCAAAATGAACAGGATTATTGGGTTGAAGCCAGAAGGAAACCCTAAAATAAACTGTACTTCCAAGACAGAAGATGTGAATCTGCAGTATTTTCCTGAAAATGGGAAGATAGACTTGATGTACTTTCCTTACTATGGGAAGAAAACCCATGTAAATTATGTTCAGCCTCTAGTAGCTGTGAAAATCATTCCTCCACCATATAATTCCTCCTTAGATGAGATTTCCCTTGAGTGCAAGATCCATGGATCCCGTAACCTTAAGAATGAGGATGAGAGAGACAAGTTCCTGGGGCGAGTGACATTCAAAGTGAAAATTTGGGTGTAA
Full Trace Sequence: cggggacgcattggtccaagctgcgctctatcggctctgcttttactgcagcgcaaggatcttacctctctccccgccatctccgctaacacaatggccaaggaagagaacaagggaagcgagcagtctggctccgactggaagcagttcatctacaacccgcagagtggagagttcatgggccgcacggctagtagttgggctctgatcctgctattctacttggtgttttatggattcctcgctgggctctttacccttaccatgtgggtcatgcttcaaacactggatgattctgtccccaaataccgagacagagtttcttctccaggtttaatgatttctcctaaatctgctgggcttgagattaaatttacccggaataagactcagtcttatcaggaatatatccagactcttcatacattccttacaccttacaatgatgccatccaagccaagaatgatctttgtgccccaggcctgtattttgatcaggacgaaaaagatgaaaagaaggcttgccagttcaacaggtcttccctcggactttgctctgggatagaagataacacgtttggatacaacgaaggcaaaccttgcgttattgtcaaaatgaacaggattattgggttgaagccagaaggaaaccctaaaataaactgtacttccaagacagaagatgtgaatctgcagtattttcctgaaaatgggaagatagacttgatgtactttccttactatgggaagaaaacccatgtaaattatgttcagcctctagtagctgtgaaaatcattcctccaccatataattcctccttagatgagatttcccttgagtgcaagatccatggatcccgtaaccttaagaatgaggatgagagagacaagttcctggggcgagtgacattcaaagtgaaaatttgggtgtaaagggaacacaagcagatttgtggccagttgtgtcattattttttgtttttgtttttttttaattatatttttttatcggcctgacctgctattcttggacctggaaccatctaggaggatgatgatttggcacatgattcagggtagcataataccaatgtgcttccaaacgtgatgttttaacctcttctgtgctgacgaggggtattccccttgctgctccagctcagaagaggttatagcccctgcatacagcatctgcctgcccattggggcgccggtttacaaaaacaatgaataaatataatggtcatttcatattaggggacttgtatatagctgtttccaaacataatactggtggtgttcgtccaatttttgatgtggttttattccattcccctcccctttgacccccactgtaaatgtgttacaagcttaatgtgttgtgctatgtaaatatttaattgatttaacactggtttaactgtcatatctccaatgcctacacagttttagggaacaacatgacacaagtaaatggtacctgaccaacctgtacaaacagtgataaaaacatacaaaaaaaaaaaaaaa
Translation: MAKEENKGSEQSGSDWKQFIYNPQSGEFMGRTASSWALILLFYLVFYGFLAGLFTLTMWVMLQTLDDSVPKYRDRVSSPGLMISPKSAGLEIKFTRNKTQSYQEYIQTLHTFLTPYNDAIQAKNDLCAPGLYFDQDEKDEKKACQFNRSSLGLCSGIEDNTFGYNEGKPCVIVKMNRIIGLKPEGNPKINCTSKTEDVNLQYFPENGKIDLMYFPYYGKKTHVNYVQPLVAVKIIPPPYNSSLDEISLECKIHGSRNLKNEDERDKFLGRVTFKVKIWV
Donor tissue: tailbud