ORFeome > bat2d – XORFeome 2.0

bat2d – XORFeome 2.0

General Information

Species: Xenopus tropicalis BAT2 domain containing 1, mRNA (cDNA clone MGC:75934 IMAGE:5383830), complete cds
Gene Symbol: bat2d
Gene ID: 394637
ORF gb_acc: MG132998
ORF ID: 10383

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC061373

Library Location

Plate ID: GDExt11004
Well Location: F06

EST Sequences

Clone: MGC:75934 IMAGE:5383830
Trimmed Sequence: ATGTCGGAGAAGTCAGGCCAGAGTACAAAAGCAAAGGATGGGAAAAAGTATGCAACCTTCAGCCTCTATAATACATACAAGGGAAAGTCTCTAGAAACTCAAAAAACCACAGTTGCTGCTCGTCATGGACTTCAAAGCCTGGGTAAAGTGGCTGTGTCCCGACGAATGCCTCCCCCTGCCAATTTGCCCAGTCTTAAAGCCGAAAACAAAGGAAACGACCCCAATGTGAACATTGTGCCTAAAGATGGCACAGGCTGGGCCTCCAAACAGGATCAATCTGAAGATGAAAAAACACCAGAAGTGCCGCCACCTCCACCAAAGCCAGTTGTCCCACCACCAGAAGTTCCTGCCGTTGCCAAATCATGGGCCAGTACGAAGCCAGGTGTGCAAGGAGAGGGAGTTCAGGTAAACCGATATTTTCAGCAAGAGTTTCCCAGTCTGCAGGCAGCTGGGGAGCAAGAAAAAACAAAAGATAAGGATGCAACAGATGATAATTATGGCCCTGGACCCAGTTTACGTCCCCAAACTGACGTAGCCAGCTGGCGAGAAGGAGGTGGAAGAAATCTTGGTACCCCCTCGGAACAGGAATCTGCTACAACAGTTCCAGAGGATGGTACCACAAATGCCTCTTTAACTGCTATCCAGGATCAGGGCAAGATCGGTGAAAAACGTGATAATAGATTACTCCCATGTGCCGCAACACAACCACAACTGAAACTTAATGGGCAGCAGCCTGGTGTACCTCCTGCATTCAGGGGTATGATGCCTCCTTTTGCTGGAAATATGTTTCCTTCATATTCAAAGCTGCCGTTTCCTCAAATGCAGGGACCGACTCGTTACCCTACTCCAGCTGAAGCCAGCAGAGCTCCTAGAGGCGAGAGACGACCAGCACATTCTTGGGCTGCTGAGGGCATTGAGCGCCCCTCCATTATTAGTGCAAATGAGTTGAAAGAGCTGGATAACCTAGACACAGAAGCAGATGAAGGCTGGGCAGGTGCACAAAGTGAGGTTGACTATACTGAACAGCTCAACTTCAGTGATGATGATGAACAGTCTTCTAGCCATAAAGAGAGATCCGAAAGCTGGTAA
Full Trace Sequence: cggtcggccatcttttctggcgccgggggttcggttgtgtgtaacatactgggcctaaaaagtgaggcatcggctgtaaaagactcgatgaatttccttcgacatgtcggagaagtcaggccagagtacaaaagcaaaggatgggaaaaagtatgcaaccttcagcctctataatacatacaagggaaagtctctagaaactcaaaaaaccacagttgctgctcgtcatggacttcaaagcctgggtaaagtggctgtgtcccgacgaatgcctccccctgccaatttgcccagtcttaaagccgaaaacaaaggaaacgaccccaatgtgaacattgtgcctaaagatggcacaggctgggcctccaaacaggatcaatctgaagatgaaaaaacaccagaagtgccgccacctccaccaaagccagttgtcccaccaccagaagttcctgccgttgccaaatcatgggccagtacgaagccaggtgtgcaaggagagggagttcaggtaaaccgatattttcagcaagagtttcccagtctgcaggcagctggggagcaagaaaaaacaaaagataaggatgcaacagatgataattatggccctggacccagtttacgtccccaaactgacgtagccagctggcgagaaggaggtggaagaaatcttggtaccccctcggaacaggaatctgctacaacagttccagaggatggtaccacaaatgcctctttaactgctatccaggatcagggcaagatcggtgaaaaacgtgataatagattactcccatgtgccgcaacacaaccacaactgaaacttaatgggcagcagcctggtgtacctcctgcattcaggggtatgatgcctccttttgctggaaatatgtttccttcatattcaaagctgccgtttcctcaaatgcagggaccgactcgttaccctactccagctgaagccagcagagctcctagaggcgagagacgaccagcacattcttgggctgctgagggcattgagcgcccctccattattagtgcaaatgagttgaaagagctggataacctagacacagaagcagatgaaggctgggcaggtgcacaaagtgaggttgactatactgaacagctcaacttcagtgatgatgatgaacagtcttctagccataaagagagatccgaaagctggtaatctaccttgcacattgtttatcttatttaaatcacagtgtacagttaaagtaaacaaaaagacaaaacccttcttgcttatatgtataattagctaaattgtgtatttgtagtggcagtgtttttgtgaaattttgtatgcaattgtatccatttttactttttgtattttcattaaaacaatcatttttttaatattcaacaaaaaaaaaaaaaaaaacaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSEKSGQSTKAKDGKKYATFSLYNTYKGKSLETQKTTVAARHGLQSLGKVAVSRRMPPPANLPSLKAENKGNDPNVNIVPKDGTGWASKQDQSEDEKTPEVPPPPPKPVVPPPEVPAVAKSWASTKPGVQGEGVQVNRYFQQEFPSLQAAGEQEKTKDKDATDDNYGPGPSLRPQTDVASWREGGGRNLGTPSEQESATTVPEDGTTNASLTAIQDQGKIGEKRDNRLLPCAATQPQLKLNGQQPGVPPAFRGMMPPFAGNMFPSYSKLPFPQMQGPTRYPTPAEASRAPRGERRPAHSWAAEGIERPSIISANELKELDNLDTEADEGWAGAQSEVDYTEQLNFSDDDEQSSSHKERSESW
Donor tissue: neurula