ORFeome > bax – XORFeome 2.0

bax – XORFeome 2.0

General Information

Species: Xenopus tropicalis BCL2-associated X protein, mRNA (cDNA clone MGC:76049 IMAGE:5307187), complete cds
Gene Symbol: bax
Gene ID: 394793
ORF gb_acc: MG132751
ORF ID: 10054

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC063201

Library Location

Plate ID: GDExt11001
Well Location: A10

EST Sequences

Clone: MGC:76049 IMAGE:5307187
Trimmed Sequence: ATGGCGACACACGGAGCCGGTGGAGATTACCCAGGGGAGGATAAAGAGAAAAACCAGGGGGAAGGCGGTGCTGCCGGGGGGCCGAGCCTTGGTGCTGCAGGGGACCGTAGCGGAACAGGTGTATCCACAGAACAGATCCTAGAAACAGGAGAGCTTCTGCTTAATGGGTTTATCTCTGACCGGCTGCAAAACAACCCTGATGTAGCTGGCGCGAGGGCGCTATTCCCAGGCTCCACCCAACATAGTGACCCTTCTATAAAGCGGCTTAGTGAGTGTCTGAGGAAAATAGGTGACGAGCTGGATGCAAACATAGAGCTGCAGAGGAGAATTGAGTGTGTACCGTGCAACTCGCCAAAGCAGGTATTTTTTCATGTAGCCAAGGAGCTGTTTGCAGATGGGGTCTTCAACTGGGGAAGAGTTGTTGCTCTGTTCTACTTTGCCTGTAAACTTGTTGTAAAGGCTCTTTGCACAAAAGTTCCTGAAATGATTCGCACCATCATTAACTGGACCATGGAATACCTGCGGGAATATGTGGTCCAGTGGATACGGGATCAAGGAGGCTGGGAAGGCATGCTGTCCTACTTTGGTACCCCTACTTGGCAAACCGTTGGTGTGTTCTTAGCTGGTGTCCTCACTGCCACCATTGCCATCTGGAAGATGTCCTAA
Full Trace Sequence: ggaatggcgacacacggagccggtggagattacccaggggaggataaagagaaaaaccagggggaaggcggtgctgccggggggccgagccttggtgctgcaggggaccgtagcggaacaggtgtatccacagaacagatcctagaaacaggagagcttctgcttaatgggtttatctctgaccggctgcaaaacaaccctgatgtagctggcgcgagggcgctattcccaggctccacccaacatagtgacccttctataaagcggcttagtgagtgtctgaggaaaataggtgacgagctggatgcaaacatagagctgcagaggagaattgagtgtgtaccgtgcaactcgccaaagcaggtattttttcatgtagccaaggagctgtttgcagatggggtcttcaactggggaagagttgttgctctgttctactttgcctgtaaacttgttgtaaaggctctttgcacaaaagttcctgaaatgattcgcaccatcattaactggaccatggaatacctgcgggaatatgtggtccagtggatacgggatcaaggaggctgggaaggcatgctgtcctactttggtacccctacttggcaaaccgttggtgtgttcttagctggtgtcctcactgccaccattgccatctggaagatgtcctaatatttagacgcagcgcttttatacctgtttttataccggaagtacatggctatttaggatccacctctgtgctgacaaactggtgcttccattaaacaggctccaagagaacattactgcaagcgtcctggggctgagaacttcagacaattaatttggggatcatgtttgattttttttttttttttcctgtgcctttttttttttttaacaatttgactttttaaactgttgtttgatataatacttgaacttcccctctcccccctaccttgtgggggcaaaaaccttagaatgtgcatgggtaatagaggaatgcagagccgcgcgtgggagcacgcctgcttgcagatgattattagaagtcagacaagaactaagaggaatgtccattttttgcataatttgcaccctgaagtttccaatttccgttatttacagagcaaaaaactttctctctcagggctgggaaaatcgcatcgtgtgttaatcacgcgcacaaccggcacttttcaggggtggtccttggacatttttttaaggtttcaatgaattggacttagagctcactgaggaattacttgcttttaggagccctcatgcctgtgattactttgcattaatggagttccttgagagcagagtagtcactagcaagatattaggcagttttcatttactgatgctcttaaaattctgatttatataaaagattttagtaagaagtctggatcagagatgtttaactagaactatctgcttactcagacaacagaaataatttactgcttaatatgtaggtaactgcttttttttccagtcacacatttgcctttccagttcagtagaacatgaatacctcataccagtttgctgtgggcagttctaggctcggcaccagggttaccttgcatttttttttgtctgactataggatttcacactgccttgtgggtctgtatccaaaggaggagacaccagtgctgattttgccaaaatcacaaaacgacaaatccagacaagttttctgcattcattagtgtcctttccttaagatacaggccccatgggcacagtgaaatgaggcataaaaatgcacagcaaggctgaaaggccctaggggtacagatgagtattttgggtctggtcttttgtcctcttatgtgaaatactcctttctttatagcgcctgggactttggggtggaccacctccacgtcagatacggttattgtccatccagcagtgaaacgcagatgcgatgtgatttagtttctgccactacactaatagcggcacacagtagccagacccaacatacttaaaggggatgtcatttttaaaatgaatatatagattcttagcactaaatgataaaactttgtaatatatgtctggtaaaaatgttggacctgtttggagagcgatccgttctgcagctttttttctctcccttgatcgcaatcctgttcaaattttgtgtgtattttattggcagcccccctgatgcttaactgttaaccctcatatagctacatatttgttttggaactgctgcccctctgagcactagggagtatagtggtcaagggagagaagaaagtagcaggcatatattacaaagcactaagaatctaaatatgtatttaaaaaaaatgactttatatattatatatatattatatatatgtaattcattgcaccttttcagacacctttcggcataaaaacttttaggggtggttcacatttaagttaacttttaatatgttatagaatggctaattctgagcaccttttcaattggtctattatttgcctcctaactctttgcggctttcaaatgggtgtgactgaccctggcagcccaaaactggctacagttttattgttattgttactttatataacatagtttctattcctctcctataactcaccactccctggttgctaaggtaatttggaccctctcaaccagctgttgaaactcaaactccaaactggatagctgccaaacaaaaactgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MATHGAGGDYPGEDKEKNQGEGGAAGGPSLGAAGDRSGTGVSTEQILETGELLLNGFISDRLQNNPDVAGARALFPGSTQHSDPSIKRLSECLRKIGDELDANIELQRRIECVPCNSPKQVFFHVAKELFADGVFNWGRVVALFYFACKLVVKALCTKVPEMIRTIINWTMEYLREYVVQWIRDQGGWEGMLSYFGTPTWQTVGVFLAGVLTATIAIWKMS
Donor tissue: gastrula