ORFeome > bmp7.1 – XORFeome 2.0

bmp7.1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis bone morphogenetic protein 7, gene 1, mRNA (cDNA clone MGC:76016 IMAGE:5384686), complete cds
Gene Symbol: bmp7.1
Gene ID: 394805
ORF gb_acc: MG133502
ORF ID: 11026

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC063373

Library Location

Plate ID: GDExt11010
Well Location: F02

EST Sequences

Clone: MGC:76016 IMAGE:5384686
Trimmed Sequence: ATGAATGTTCTGCAAAAGAACAAAACGGGTTCTGTGCTCCTTTGGACATACTTCTTGTGGAGGATCATCCTGGCCGACTTCACCTTGGACAATGAGGTGCACTCTAGTTTTATCCAAAGGAGGTTGCGAGGCCAAGAGCGCAGGGAGATGCAGAGAGAGATTTTATCCATCCTGGGGCTGCCGCACAGACCCAGACCCCATTTGTATGGAAAGCAAAATTCTGCCCCTATGTTTATGCTGGATTTGTACAATGCTATGACAGTGGACGAAGAGGAAGCTGAAGGCTTCTCTTATCCATACAAGCCCATCTTTACCACCCAGGGGCCACCGCTGGCCAGCCAACAGGACAGCAACTTCCTCAATGACGCCGACATGGTTATGAGTTTTGTTAATCTAGTGGAGCACGACAAAGAATTCTTCCATCAGAGGCGGCACCACCGGGAATTCCGCTTCGACATTGCCAAAATCCCAGAGGGCGAAGCGGTGACGGCGGCCGAGTTCAGGATATATAAGGATTATATCCGGGAAAGGTTTGAAAATGAGACTTTCCAGATCAGCGTCTACCAAGTCCTGCAGGAACACCAGGGCAGAGATTCTGACCTGTATGAACTGGACTCTAGAACGATCTGGGCGGCAGAAGAAGGATGGCTGGTGTTCGATATCACAACTACCAGTAACCACTGGGTGGTGAACCCCCAACACAACCTTGGACTGCAGCTGTCTGTGGAGAGTATCGATGGACAGAGCATCAACCCCAAAATGGCCGGACTGATAGGAACCAATGGGCCGCACAATAAACAGCCCTTCATGGTGGCGTTCTTCAAAGCCACAGAAATCCACCTGCGCAGCATTCGATCTGCCGGCGGAAAGCACCGGAACCAAAACAGATCCAAAGCACCAAAGAGCCAAGAGGCGCTACGGGTGTCAAATATTGCAGAAAACAGCAGCACTGATCAAAAGCAGGCGTGCAAGAAACACGAGTTATACGTCAGCTTCAAGGACCTTGGCTGGCAGGACTGGATTATTGCCCCCGAGGGATACGCAGCATTTTACTGTGAAGGGGAGTGTGCATTCCCTCTCAATTCATACATGAACGCCACCAATCATGCCATCGTACAGACGCTGGTCCATTTCATTAACCCGGACACCGTCCCAAAGCCGTGCTGCGCCCCCACCCAGCTCAACCCCATCTCCGTCCTTTACTTTGACGACAGTTCCAATGTCATCCTGAAGAAATACAGAAACATGGTGGTCCGGGCCTGCGGCTGCCACTGA
Full Trace Sequence: cctgttacaaagtctcacaatgactgggttcagctgatgcagaggaagcctccagctgttccaagttagtgagaacttcagctgagagttggatgcactggtttgatttaatgctcatttattgatggtctcccctttggagagaagggcaggtgctgtaggttttgccgtacagatccaagggaaatgaatgttctgcaaaagaacaaaacgggttctgtgctcctttggacatacttcttgtggaggatcatcctggccgacttcaccttggacaatgaggtgcactctagttttatccaaaggaggttgcgaggccaagagcgcagggagatgcagagagagattttatccatcctggggctgccgcacagacccagaccccatttgtatggaaagcaaaattctgcccctatgtttatgctggatttgtacaatgctatgacagtggacgaagaggaagctgaaggcttctcttatccatacaagcccatctttaccacccaggggccaccgctggccagccaacaggacagcaacttcctcaatgacgccgacatggttatgagttttgttaatctagtggagcacgacaaagaattcttccatcagaggcggcaccaccgggaattccgcttcgacattgccaaaatcccagagggcgaagcggtgacggcggccgagttcaggatatataaggattatatccgggaaaggtttgaaaatgagactttccagatcagcgtctaccaagtcctgcaggaacaccagggcagagattctgacctgtatgaactggactctagaacgatctgggcggcagaagaaggatggctggtgttcgatatcacaactaccagtaaccactgggtggtgaacccccaacacaaccttggactgcagctgtctgtggagagtatcgatggacagagcatcaaccccaaaatggccggactgataggaaccaatgggccgcacaataaacagcccttcatggtggcgttcttcaaagccacagaaatccacctgcgcagcattcgatctgccggcggaaagcaccggaaccaaaacagatccaaagcaccaaagagccaagaggcgctacgggtgtcaaatattgcagaaaacagcagcactgatcaaaagcaggcgtgcaagaaacacgagttatacgtcagcttcaaggaccttggctggcaggactggattattgcccccgagggatacgcagcattttactgtgaaggggagtgtgcattccctctcaattcatacatgaacgccaccaatcatgccatcgtacagacgctggtccatttcattaacccggacaccgtcccaaagccgtgctgcgcccccacccagctcaaccccatctccgtcctttactttgacgacagttccaatgtcatcctgaagaaatacagaaacatggtggtccgggcctgcggctgccactgaagccgacggaacgttctaggcgcgttgactcgccgcgagcgaacccagcaacgcagactgtaaccttgttttgtagattcatactcagcgtcagtgtccgagctcttcgttgggtctctgtgactcttttccgcatcggttaagtaaaggcagaacgtctcggacagagaggtattgtttgttttgcctttaattcaagcaagaaaatgtaaatatggagaaaagatggatcgccgctgcctgcagtgtacgccataccgccaccaaggaaggggccggagatgtggcccctaatgctgtctatttaatatcactcctttggtgtttagttatactctcgccggggtagatcttgtaccttagttccgttcattcgagcagacggagcatagaagagtcctgttgccatcagagaggattctgggaaacagagacgtggggtattttttgtacatgagagtttgaattgtgcctctttattaaactccaaagactggggatatgttttcagacaacggaaatatgtacaggtaataaagataataaatccaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MNVLQKNKTGSVLLWTYFLWRIILADFTLDNEVHSSFIQRRLRGQERREMQREILSILGLPHRPRPHLYGKQNSAPMFMLDLYNAMTVDEEEAEGFSYPYKPIFTTQGPPLASQQDSNFLNDADMVMSFVNLVEHDKEFFHQRRHHREFRFDIAKIPEGEAVTAAEFRIYKDYIRERFENETFQISVYQVLQEHQGRDSDLYELDSRTIWAAEEGWLVFDITTTSNHWVVNPQHNLGLQLSVESIDGQSINPKMAGLIGTNGPHNKQPFMVAFFKATEIHLRSIRSAGGKHRNQNRSKAPKSQEALRVSNIAENSSTDQKQACKKHELYVSFKDLGWQDWIIAPEGYAAFYCEGECAFPLNSYMNATNHAIVQTLVHFINPDTVPKPCCAPTQLNPISVLYFDDSSNVILKKYRNMVVRACGCH
Donor tissue: neurula