ORFeome > btg1 – XORFeome 2.0

btg1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis B-cell translocation gene 1, anti-proliferative, mRNA (cDNA clone MGC:75680 IMAGE:5380134), complete cds
Gene Symbol: btg1
Gene ID: 394522
ORF gb_acc: MG132849
ORF ID: 10201

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061606

Library Location

Plate ID: GDExt11002
Well Location: E07

EST Sequences

Clone: MGC:75680 IMAGE:5380134
Trimmed Sequence: ATGCATACGCACTATCCCTGGGCCAACATGAAGCCAGAGATCATGGCGGCGGTGAGTTTCATCTCAAAGTTCCTCCGAACCAAAGGCCTCATGAACGACCTCGACCTGCAGACGTTTAACCAGTCTTTACAGGAGCTCCTGGCCGATCACTATAAGCATCATTGGTTTCCAGAAAAGCCGTCAAGGGGTTCAGCCTATCGATGTATTCGGATTAACCACAAGATGGACCCTTTAATTGGAGAGGCAGCAGATCGTATTGGACTCAACAGCCAGCAAATGTTTAAGCTTCTGCCAAGTGAACTTACTTTGTGGGTTGACCCATATGAAGTATCGTATCGCATAGGAGAGGATGGCTCTATTTGTGTATTGTATGAATCTGTTCCAGGAGGTGGTATTAGTCCAAGCAGCAGTGGCTCTCTAGTTGAGAGTAGGATCAGCTGTAAAGATGAACTCCTCTTGGGCCGAACAAGCCCATCCAAAACGTACAACATGATGACTGTATCTGGTTAA
Full Trace Sequence: attaacttgcacgccatgccagggcgcagcttgtaaaaccaccaaggacgtaaaagtgaaaaatataaaaaaaaaaaaattgtaaaacacgaataaaaatccatcaaacaggaccaagcggagcgcaatagacgatccgtgctgttccatcggtgttcgtatcgctgtcggtcgcgctcccatgcatacgcactatccctgggccaacatgaagccagagatcatggcggcggtgagtttcatctcaaagttcctccgaaccaaaggcctcatgaacgacctcgacctgcagacgtttaaccagtctttacaggagctcctggccgatcactataagcatcattggtttccagaaaagccgtcaaggggttcagcctatcgatgtattcggattaaccacaagatggaccctttaattggagaggcagcagatcgtattggactcaacagccagcaaatgtttaagcttctgccaagtgaacttactttgtgggttgacccatatgaagtatcgtatcgcataggagaggatggctctatttgtgtattgtatgaatctgttccaggaggtggtattagtccaagcagcagtggctctctagttgagagtaggatcagctgtaaagatgaactcctcttgggccgaacaagcccatccaaaacgtacaacatgatgactgtatctggttaagatatggttgatggctggatcatcttgtagcagatggaaaccaattattgtttttaatttgggagggctcctatggggatggattgtgaagtttatacaatgacgcagctgtgaagattggacacaaatagtggtagatctttctgaagtgaaagtgcctttgtttagacagtgtctttggcaattttatagcctgttatttacgcaaatagatttaaaaaaaaaaaaaaaaa
Translation: MHTHYPWANMKPEIMAAVSFISKFLRTKGLMNDLDLQTFNQSLQELLADHYKHHWFPEKPSRGSAYRCIRINHKMDPLIGEAADRIGLNSQQMFKLLPSELTLWVDPYEVSYRIGEDGSICVLYESVPGGGISPSSSGSLVESRISCKDELLLGRTSPSKTYNMMTVSG
Donor tissue: tadpole