ORFeome > cacng1 – XORFeome 2.0

cacng1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis calcium channel, voltage-dependent, gamma subunit 1, mRNA (cDNA clone MGC:69382 IMAGE:5335251), complete cds
Gene Symbol: cacng1
Gene ID: 496444
ORF gb_acc: MG133297
ORF ID: 10788

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC084053

Library Location

Plate ID: GDExt11008
Well Location: C05

EST Sequences

Clone: MGC:69382 IMAGE:5335251
Trimmed Sequence: ATGAAGGAGCTGAAGGTGCTGAAGATCCGGGTCACGTCCTGTATCGCCCTGGTGGGCATCTCGCTCATGTTGGCGGCCGTAATGAGCGACCACTGGGCCGTACTGAGCCCCAAACTGGACGACGACACCCAGTCCTGCGAGGTGGCCCACTTTGGCCTATGGAGGCTGTGTAAGAAGAAGATTTTCATGAGTGATCAGGAGACTATGATCAAGGGATGTGGCCCCCTGAGCCTTCCTGGGGAGCACAGCTGCACCTACTTCAAGCATTTCACTTCAGGGGAGAACGCGGATATTTTCGAGGTGACGACGCAGAAAGAGTACAGCATCTCGGCAGCCGCCATCGCCATCATCGGAGTGGGGTTCATGACTATGGGCACAGTGTGCACCCTGCTGTCCTTCAAGGAGAAGCTCGACTACCTGCTCAAACCCGCCGGCCTCTTCTTCATCTTTGCAGGGCTGTGCATGATTATCTCGGCGGAAGTGATCAGACAGTCGGTGCACCGGATGATAGACAGTAAGGAGACGGTCTGGATCGAGTATTATTATTCGTGGTCCTTCGCCTGCGCCTGCGCCGCCTTCGTGCTGCTGTTCGTGTGCGGCGTCGCCCTGGTGCTCATCTCCCTGCCGCGCATGCCCAGGAACCCCTGGGAGACCTGTATGGACGCGGAGCCCGACATGTGA
Full Trace Sequence: cacagagcagagggaatagactgagcgctcactagccaagggccccagccagtagccatgaaggagctgaaggtgctgaagatccgggtcacgtcctgtatcgccctggtgggcatctcgctcatgttggcggccgtaatgagcgaccactgggccgtactgagccccaaactggacgacgacacccagtcctgcgaggtggcccactttggcctatggaggctgtgtaagaagaagattttcatgagtgatcaggagactatgatcaagggatgtggccccctgagccttcctggggagcacagctgcacctacttcaagcatttcacttcaggggagaacgcggatattttcgaggtgacgacgcagaaagagtacagcatctcggcagccgccatcgccatcatcggagtggggttcatgactatgggcacagtgtgcaccctgctgtccttcaaggagaagctcgactacctgctcaaacccgccggcctcttcttcatctttgcagggctgtgcatgattatctcggcggaagtgatcagacagtcggtgcaccggatgatagacagtaaggagacggtctggatcgagtattattattcgtggtccttcgcctgcgcctgcgccgccttcgtgctgctgttcgtgtgcggcgtcgccctggtgctcatctccctgccgcgcatgcccaggaacccctgggagacctgtatggacgcggagcccgacatgtgaggggagattccggggggtcacggaccggagatggacccccgacattcactgactgaactcaatgggcgagtgagggcagagggggtggcgcaccccaatatctcgcttctttcctgtatagtgtaagctcctccccaaggcttggccaatggcgtaaccaggaattactgggccccacagcaaattcattttgggcccccaccccctgtatggaacccctctgggtgtgtaactagtgggagggggatttgggggcccccaccccctgtatggaacccctctgggtaactagtgggagggggatttgggggaccccaccccctgtatggaacccctctgggtgtgtaactagtgggagggggatttgggggaccccaccccctgtatggaacccctctgggtaactagtgggagggggatttgggggaccccaccccctgtatggaacccctctgggtaactagtgggagggggatttgggggaccccaccctctgtatggaacccctctgggtgtgtaactagtgggagggggatttaggggcccccaccccctgtatggaacccctctgggtaactagtgggagggggatttgggggaccccaccccctgtatggaacccctctgggtaactagtgggagggggatttgggggcagcccccctacagcagctgggattctctccctgcccccagcacctttatttactggattatttcactggctttaaatagcgtcccccggcctgtgcccccccccattacaggaatagacaccgacccatagggagactgagggactcacagggcgtcgttacagctgcagagtcggggggctcagggggtgggaagatatgagaaataatgtgtgactttggcctttgtggtgtttatctaatcactgaatgtctttaaatttcaagggtaaatagaaccaagttttactttaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MKELKVLKIRVTSCIALVGISLMLAAVMSDHWAVLSPKLDDDTQSCEVAHFGLWRLCKKKIFMSDQETMIKGCGPLSLPGEHSCTYFKHFTSGENADIFEVTTQKEYSISAAAIAIIGVGFMTMGTVCTLLSFKEKLDYLLKPAGLFFIFAGLCMIISAEVIRQSVHRMIDSKETVWIEYYYSWSFACACAAFVLLFVCGVALVLISLPRMPRNPWETCMDAEPDM
Donor tissue: tailbud