ORFeome > cd81 – XORFeome 2.0

cd81 – XORFeome 2.0

General Information

Species: Xenopus tropicalis CD81 protein, mRNA (cDNA clone MGC:75667 IMAGE:5379940), complete cds
Gene Symbol: cd81
Gene ID: 394885
ORF gb_acc: MG132820
ORF ID: 10167

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064182

Library Location

Plate ID: GDExt11002
Well Location: A09

EST Sequences

Clone: MGC:75667 IMAGE:5379940
Trimmed Sequence: ATGGGGGTAGAAGGATGCACCAAATGCATTAAATATCTGCTCTTTGTCTTCAACTTCATCTTCTGGCTGGCTGGAGGTGTGATTCTCGGGGTAGCACTGTGGCTTCGACATGACCCCCAAACTTCCAACCTACTTTTCCAGCAGTTTGAGGACAAGCACGCACCAGGGACTTTCTACATTGGTGTCTATATAATAATAGCAGTAGGCGCTGTCATGATGTTTGTGGGATTCCTGGGATGTTATGGGGCCATTCAGGAATCTCAGTGCCTTCTGGGAACGTTCTTTGCGTGCCTGGTGATCCTCTTCGCCTGTGAGGTGGCTGCTGGTATCTGGGGCTTTGTGAACAGGGATCAGGTTTCAAAGGAAATGCGGCTTTTCTACAGTGAAGTGTATCAACATGCAACCACCGGGACTAAGGAACAGCAGCAAAAGGCTCTCCCTGTGCTCAAGGCCTTCCATGAGACACTGCAGTGCTGTGGCGACGCCAGTCTTAAAAAATATGTCACCATGAGCATCACCGATATGTGTCCGAAGCGTAGTAATATCCTAGAGCAAATCACCATAGAGGACTGCCACCAGAAAATTGACGTCCTCTTTTCTACAAAGCTTTATTTGGTTGGCATCGCTGCTGTTGTGGTGGCCGTTATTATGATCATCGAGATGATATTCAGTATGGTCCTGTGCTGTGGCATCCGGATTTATTCTGTATACTAA
Full Trace Sequence: ccgctctcgcatctctgatccgctttacagctaataagggacaggggaacgctcagcgcagccgccatgggggtagaaggatgcaccaaatgcattaaatatctgctctttgtcttcaacttcatcttctggctggctggaggtgtgattctcggggtagcactgtggcttcgacatgacccccaaacttccaacctacttttccagcagtttgaggacaagcacgcaccagggactttctacattggtgtctatataataatagcagtaggcgctgtcatgatgtttgtgggattcctgggatgttatggggccattcaggaatctcagtgccttctgggaacgttctttgcgtgcctggtgatcctcttcgcctgtgaggtggctgctggtatctggggctttgtgaacagggatcaggtttcaaaggaaatgcggcttttctacagtgaagtgtatcaacatgcaaccaccgggactaaggaacagcagcaaaaggctctccctgtgctcaaggccttccatgagacactgcagtgctgtggcgacgccagtcttaaaaaatatgtcaccatgagcatcaccgatatgtgtccgaagcgtagtaatatcctagagcaaatcaccatagaggactgccaccagaaaattgacgtcctcttttctacaaagctttatttggttggcatcgctgctgttgtggtggccgttattatgatcatcgagatgatattcagtatggtcctgtgctgtggcatccggatttattctgtatactaaggaacgtctttattctcctatgtatataaatccttgtcttattcctcttcccccaaaccctcccaacgtctccctttcaatttttttttttttcttttttaaatatcctaccctcttggcgatcgagtcagtgtcccgccagtgcagtggattcctagcttggactatccctatgtctgtatgagcgatgctctaggtatttcttcaacaagacactcgggaattcgggtgcccttgaatgtatacggcctgcttgcagggctctgacttccagtttacagcttctgcggtcagaaggacgcatcatcttgtgtttgccgcgcaataagatactaaagagttccgtggtaggccggctgaattcagccacgtgctacaatcaagtctgtgtgcgtccggccactctttactttcttattgctgtcgagtcacaatctctccccgtttcacgtgtaaaagatgttgtgttcgtacttttgggagaggagtcaatccatattccttgcacgatggcccctatttcctacactccatcattacatagtaaatatatatataaatataaacatgtaaaaagattctgattaaaatcctttgggggctttttttttccccccactgacaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MGVEGCTKCIKYLLFVFNFIFWLAGGVILGVALWLRHDPQTSNLLFQQFEDKHAPGTFYIGVYIIIAVGAVMMFVGFLGCYGAIQESQCLLGTFFACLVILFACEVAAGIWGFVNRDQVSKEMRLFYSEVYQHATTGTKEQQQKALPVLKAFHETLQCCGDASLKKYVTMSITDMCPKRSNILEQITIEDCHQKIDVLFSTKLYLVGIAAVVVAVIMIIEMIFSMVLCCGIRIYSVY
Donor tissue: tadpole