ORFeome > cdc2l6 – XORFeome 2.0

cdc2l6 – XORFeome 2.0

General Information

Species: Xenopus tropicalis cell division cycle 2-like 6 (CDK8-like), mRNA (cDNA clone MGC:76204 IMAGE:5336065), complete cds
Gene Symbol: cdc2l6
Gene ID: 394856
ORF gb_acc: MG132778
ORF ID: 10093

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC063921

Library Location

Plate ID: GDExt11001
Well Location: D12

EST Sequences

Clone: MGC:76204 IMAGE:5336065
Trimmed Sequence: ATGGACTATGACTTCAAGGTGAAGCTGACAGGCGAGCGGGAGAGGGTGGAGGACCTGTTTGAGTACGAGGGCTGCAAAGTTGGAAGAGGCACTTATGGGCATGTGTACAAAGCCAAGCGGAAAGATGGGAGAGATGACCGAGATTATGCTTTAAAACAAATAGAAGGTACTGGAATTTCTATGTCTGCATGCAGAGAAATTGCACTTCTGCGGGAGCTGAAACATCCAAATGTAATTTCCCTACAGAAAGTGTTCCTTTCGCACGCTGACAGGAAAGTCTGGCTTCTGTTTGACTTTGCAGAGCATGACTTATGGCACATAATCAAATTTCACAGGGCCTCGAAAGCAAACAAGAAACCTGTGCAGTTACCTCGGGGAATGGTGAAGTCACTACTTTATCAGATTTTAGATGGAATTCACTACCTGCATGCAAACTGGGTTTTACATAGAGATTTGAAACCTGCAAACATTTTGGTCATGGGTGAAGGTCCGGAACGAGGACGAGTAAAAATAGCGGACATGGGATTTGCCCGGTTATTTAATTCACCTTTAAAGCCTTTAGCAGATTTAGACCCTGTAGTTGTTACATTCTGGTATCGAGCCCCAGAGTTATTGCTAGGGGCACGCCATTATACCAAAGCTATTGATATTTGGGCTATAGGATGTATATTTGCAGAGCTTCTAACGTCGGAGCCAATTTTTCATTGTCGACAGGAAGATATCAAAACTAGTAACCCTTATCATCATGACCAGCTGGATAGAATATTTAATGTCATGGGATTTCCTGCAGATAAAGATTGGGAAGACATTAAAAAGATGCCTGAGCATTCAACTCTAATAAAGGACTTCCGCAGGAATACGTACACCAACTGCAGCCTTATAAAATACATGGAAAAGCATAAAGTAAAACCAGACAGCAAAACATTCCACTTGCTTCAGAAATTGCTCACAATGGACCCAATCAAAAGAATTTCCTCAGAGCAAGCTATGCAGGATCCATATTTTCTAGAAGATCCACTTCCTACTTCAGATGTTTTTGCAGGCTGCCAGATTCCATATCCCAAGCGAGAGTTTTTGACAGAAGAGGAACCCGATGATAAGGGAGACAAAAAAAACCAACAGCAGCAGCAAGGCAATAACCATACTAATGGAACCGGTCACCCAGGAAACCAAGATAACAGTCACGCACAAGGGCCACCTTTAAAGAAAGTGAGAGTTGTACCCCCTACCACTACCTCAGGTGGGCTCATAATGACCTCAGACTATCAGCGTTCCAATCCACATGCTGCTTATCAAAACCCTGGACCAAGCACATCACAACCTCAGAGCAGCATGGGGTATTCGTCTACCTCCCAGCAGCCTCCGCAGTACTCCCATCAGACCCACCGGTACTGA
Full Trace Sequence: cggctgttgtggagctgtagggctgcaggctgtgcctcctcacttgcccggctgtacatgctgctcttccccgggcaccgagcacacgccgctaaacatggactatgacttcaaggtgaagctgacaggcgagcgggagagggtggaggacctgtttgagtacgagggctgcaaagttggaagaggcacttatgggcatgtgtacaaagccaagcggaaagatgggagagatgaccgagattatgctttaaaacaaatagaaggtactggaatttctatgtctgcatgcagagaaattgcacttctgcgggagctgaaacatccaaatgtaatttccctacagaaagtgttcctttcgcacgctgacaggaaagtctggcttctgtttgactttgcagagcatgacttatggcacataatcaaatttcacagggcctcgaaagcaaacaagaaacctgtgcagttacctcggggaatggtgaagtcactactttatcagattttagatggaattcactacctgcatgcaaactgggttttacatagagatttgaaacctgcaaacattttggtcatgggtgaaggtccggaacgaggacgagtaaaaatagcggacatgggatttgcccggttatttaattcacctttaaagcctttagcagatttagaccctgtagttgttacattctggtatcgagccccagagttattgctaggggcacgccattataccaaagctattgatatttgggctataggatgtatatttgcagagcttctaacgtcggagccaatttttcattgtcgacaggaagatatcaaaactagtaacccttatcatcatgaccagctggatagaatatttaatgtcatgggatttcctgcagataaagattgggaagacattaaaaagatgcctgagcattcaactctaataaaggacttccgcaggaatacgtacaccaactgcagccttataaaatacatggaaaagcataaagtaaaaccagacagcaaaacattccacttgcttcagaaattgctcacaatggacccaatcaaaagaatttcctcagagcaagctatgcaggatccatattttctagaagatccacttcctacttcagatgtttttgcaggctgccagattccatatcccaagcgagagtttttgacagaagaggaacccgatgataagggagacaaaaaaaaccaacagcagcagcaaggcaataaccatactaatggaaccggtcacccaggaaaccaagataacagtcacgcacaagggccacctttaaagaaagtgagagttgtaccccctaccactacctcaggtgggctcataatgacctcagactatcagcgttccaatccacatgctgcttatcaaaaccctggaccaagcacatcacaacctcagagcagcatggggtattcgtctacctcccagcagcctccgcagtactcccatcagacccaccggtactgagctgtacccaagggaaacaacatcacaaagtcaatgcactgttgctttggctgcaggactgagcatgtagctgtctgcctgaagcctggctttggaatgtactgtacaaccacaccttcaaaatgtccagcagccaagttacacaacatttcagagaatgtagaccccccccccccccatgtgaaggttaagagtgctagctcagttggcgcagtcgtggatttgctacttccatagtttacttgaatatggttcaaactgaccaatgcatattctcttcagtgatggtagcagttgaagctgtgaagtatgttaggaacaaacactttgtttttcatggtgacttctcacaatatgatctgaccaataagaaacggtcttctctggtatggacattaaccagcacgctaaatcgtactgctgttctgtttgctacacgtttctttctgtatagttttcaggtgataccagatgatcacctccatcagtgttttataaccagcaaatcttgttcctccgacaccttccccctaaacaaaaagcaacaacgaaaaaaaagcaacgtttggcctttatttcccctttacgagcctcccaaagattctatttcagcataggtttttaaggactttttaacttgactagtattaaagctgctatctgatattaaatataccaacctgtttgcagaggcaaacaagggcaaccgatcatcatcaactttttttttgtttgttttgtttttcccccctgttggtgttgctgaattgtgagcatgctatggagttctgactaaataaaaagcaaaaaaaaaatagtgaaaacagaaaaaaaaaaaaaaaa
Translation: MDYDFKVKLTGERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGRDDRDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDFAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLIKDFRRNTYTNCSLIKYMEKHKVKPDSKTFHLLQKLLTMDPIKRISSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDNSHAQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYQNPGPSTSQPQSSMGYSSTSQQPPQYSHQTHRY
Donor tissue: tailbud