ORFeome > cldn6.1 – XORFeome 2.0

cldn6.1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis claudin 6, gene 1, mRNA (cDNA clone MGC:75756 IMAGE:5381593), complete cds
Gene Symbol: cldn6.1
Gene ID: 394468
ORF gb_acc: MG132953
ORF ID: 10329

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC059750

Library Location

Plate ID: GDExt11004
Well Location: A02

EST Sequences

Clone: MGC:75756 IMAGE:5381593
Trimmed Sequence: ATGGCTTCTACTGGTCTCCAGATCCTTGGCATGGCTCTTGCCCTCATTGGCTGGGTGGGAAGTATAATCACCTGTGCCCTGCCCATGTGGAGGGTGACTGCCTTCATTGGGAACAACATAGTCGTGGCCCAGATTATATGGGAAGGCCTGTGGATGAATTGCATTGTGCAGAGTACCGGACAGATGCAGTGCAAGGTCTATGACTCCATGTTGGCTCTCTCCCAGGACTTGCAGGCTGCCCGTGCCCTTACTGTCATCTGTATCCTGGTAGCCCTGCTAGCCATTCTTATTGGTATTGTGGGAGCCAAGTGCACCAACTGCATAGAAGATGAGAACACCAAGGCCAAGGTCAGCATGATATCCGGCATTGTATTTGTGGTGTCTGGTATCCTCATGCTCATCCCAGTCTGCTGGTCTGCAAACAGCATCATCCGTGACTTCTACAATCCCCTGGTGGTGGAGGCTCAGAAGAGAGAACTGGGGGCTGCCTTGTACATTGGATGGGCTGCCTCTGGTCTGCTGCTCATGGGTGGAGCCCTCTTGTGCTGCTCTTGCCCCAAGAAGGATGACAACCATTACTCAGCCAGATACACCGCTGCTACCTCCAACCCACGAAGCGACTACCCCAGCAAGAATTATGTCTGA
Full Trace Sequence: gttggctgaatccttactgcagatttctccactttgacaacttcactgtacaaagatggcttctactggtctccagatccttggcatggctcttgccctcattggctgggtgggaagtataatcacctgtgccctgcccatgtggagggtgactgccttcattgggaacaacatagtcgtggcccagattatatgggaaggcctgtggatgaattgcattgtgcagagtaccggacagatgcagtgcaaggtctatgactccatgttggctctctcccaggacttgcaggctgcccgtgcccttactgtcatctgtatcctggtagccctgctagccattcttattggtattgtgggagccaagtgcaccaactgcatagaagatgagaacaccaaggccaaggtcagcatgatatccggcattgtatttgtggtgtctggtatcctcatgctcatcccagtctgctggtctgcaaacagcatcatccgtgacttctacaatcccctggtggtggaggctcagaagagagaactgggggctgccttgtacattggatgggctgcctctggtctgctgctcatgggtggagccctcttgtgctgctcttgccccaagaaggatgacaaccattactcagccagatacaccgctgctacctccaacccacgaagcgactaccccagcaagaattatgtctgagaacaagagctacctggctatgcatggactttcttttctaataatgtgtcgggggttctccagcaagagcacttgaactgaaggggggtgtcggcttctggagactgttatgggactcttagcctggttcaggcttttatggaaattaatggtttaataaaacattggttttttttttgtaaaaaaaaaaaaaaaaaaaaaa
Translation: MASTGLQILGMALALIGWVGSIITCALPMWRVTAFIGNNIVVAQIIWEGLWMNCIVQSTGQMQCKVYDSMLALSQDLQAARALTVICILVALLAILIGIVGAKCTNCIEDENTKAKVSMISGIVFVVSGILMLIPVCWSANSIIRDFYNPLVVEAQKRELGAALYIGWAASGLLLMGGALLCCSCPKKDDNHYSARYTAATSNPRSDYPSKNYV
Donor tissue: tadpole