ORFeome > clic4 – XORFeome 2.0

clic4 – XORFeome 2.0

General Information

Species: Xenopus tropicalis chloride intracellular channel 4, mRNA (cDNA clone MGC:89006 IMAGE:7004397), complete cds
Gene Symbol: clic4
Gene ID: 448566
ORF gb_acc: MG134163
ORF ID: 11797

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC076899

Library Location

Plate ID: GDExt11017
Well Location: B11

EST Sequences

Clone: MGC:89006 IMAGE:7004397
Trimmed Sequence: ATGACAGACTCTGCTCCGACTAACGGGGAGGAAAGGGATCCGGATATAGAACTTTTTGTAAAGGCTGGGAGCGATGGAGAGAGCATAGGGAACTGCCCCTTCTCCCAGCGCCTGTTTATGATCCTCTGGCTGAAGGGAGTAGTCTTCAACGTTACCACAGTAGATCTGAAAAGAAAACCGGCCGACCTCCATAACTTAGCTCCCGGGACTCACCCACCTTTCCTGACCTTCAATGGGGAAGTAAAGACGGACGTGAACAAGATAGAAGAGTTCCTGGAGGAATCATTGGCACCCCCAAGGTACCCCAAACTGGCTGCAAAGCATCGCGAGTCCAACACTGCCGGGATTGATATCTTCTCCAAATTCTCAGCCTACATTAAAAACACAAAGCAGCAGGACAATGCCGGCCTAGAGAAGGGTCTGACAAAAGCCCTGAAGAAACTCGACACATACCTGAACTCGCCGCTGCCTGAAGAGATCGATGCCAACAGCCGAGAGGAAGAGAAAGTATCAAAGCGGAAGTTTCTAGATGGGGATGAGTTTACCCTGGCTGACTGCAACCTCCTGCCCAAGCTCCATGTTGTCAAGATTGTCGCAAAGAAATACCGCAACTATGAAATCCCAGCGGAGATGAGTGGCATCTGGCGGTACCTGAAGAACGCTTACGCCAGAGACGAGTTTACCAACACGTGCGCCGCGGATAAAGAGACAGAGCTAGCCTACGCCGACGTGGCGAAAAGGCTCTCCAAGTAA
Full Trace Sequence: gtttgtgacataaggatccgacacaagggaggacactgctgtctgtgtgagtgtggaacacgcagaagggaatgccctgacacctgcccactccccccaggcatgaaggatgctgccttagcaccaaggactgctccttagggtgccctatgtgccagccgggcaccttgtgaggctgataaactgcaccaagcactttgggatattctcgcacttgaccaatcggaaagcaggaaatattcctcaatataaacaaaacaatgacagactctgctccgactaacggggaggaaagggatccggatatagaactttttgtaaaggctgggagcgatggagagagcatagggaactgccccttctcccagcgcctgtttatgatcctctggctgaagggagtagtcttcaacgttaccacagtagatctgaaaagaaaaccggccgacctccataacttagctcccgggactcacccacctttcctgaccttcaatggggaagtaaagacggacgtgaacaagatagaagagttcctggaggaatcattggcacccccaaggtaccccaaactggctgcaaagcatcgcgagtccaacactgccgggattgatatcttctccaaattctcagcctacattaaaaacacaaagcagcaggacaatgccggcctagagaagggtctgacaaaagccctgaagaaactcgacacatacctgaactcgccgctgcctgaagagatcgatgccaacagccgagaggaagagaaagtatcaaagcggaagtttctagatggggatgagtttaccctggctgactgcaacctcctgcccaagctccatgttgtcaagattgtcgcaaagaaataccgcaactatgaaatcccagcggagatgagtggcatctggcggtacctgaagaacgcttacgccagagacgagtttaccaacacgtgcgccgcggataaagagacagagctagcctacgccgacgtggcgaaaaggctctccaagtaattcagctctggaagcgaaattccccggcgctaaagtgttctcacactcacagactgatctccttgttgccttaggatccatctacacaccaaatgggttgaacaattctgcttctggataggccggctgtgtgtgtgactttgaaatacgtcgccgccgactgcattgaaaaccaagccgtgatttcttgctcttgagaggtggcgaactatgttattttttaaagggaaaagttgatcagaatgagaaaaaaaccccgatatctctgacacccaatcaaatcttaaggcaacacgcgctatctataaagtatttttgtattggaagctgattcctttatcagtgatttatgaaatgtattatttcacagggaatgtatattcttagtgattctataaagcttaataataatagtaataataataatattaataaccgggagaatgctttcttctaatagtagagttattcatggtagagcagcttctcctagttggggttaatatactcctgggggggcagagactggtctggatttaccccacggcagcctcggtgtaacatggaaactgaagatggagagaatcagaaaggacggatggaaatgttttgaaaggttggaaataaagagagagatattaagtgctgagatgataaagagacgctgaaagaatggtaaatagagaagggaaggagccggggaacttccgtggcacccgtttaggctcgtggcacaggcaggtgttggcctgaaatccaatgcacattttcagggtgaaatctgcctataccagagcctcaggtgtatgtttattgccctattgcccctgagcagctgagggactgcaccattgtctggttatggtcacatgaagcagctacggccaccagggtgactccccggcagcggataattccggcaagcactaagctgctactgtgcagagagggccggggagtgaagacaacaaaagcaacaaggtctttgggcgtcagctgggaaatatagggagaaggagctccaggaactgctcacatctgccatgatacactttgtgtaggctcatttggtgtcctcaaatcactagaaccagtgtattttggcccaaaatgtctgtacgtttccaggcagagattcaccttggatttcaattaaaatcatttttggccaacactgctataggctaagagcctgtcaatattcaaccttctgccatagggcctcgggtagccttggggtaagtttggaacctgctgggggttctgtaacagcccaaaggtgtcctatccctgctccagattgttagtaagtatggccctgcgaagcacagggatgtgagaggtttgtaccagaatatacccgttgggtgtacttaacaagggtaagggtgccttatatgaatacaaaataaatgtatttgaaatattgaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MTDSAPTNGEERDPDIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGEVKTDVNKIEEFLEESLAPPRYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQDNAGLEKGLTKALKKLDTYLNSPLPEEIDANSREEEKVSKRKFLDGDEFTLADCNLLPKLHVVKIVAKKYRNYEIPAEMSGIWRYLKNAYARDEFTNTCAADKETELAYADVAKRLSK
Donor tissue: