ORFeome > clip4 – XORFeome 2.0

clip4 – XORFeome 2.0

General Information

Species: Xenopus tropicalis CAP-GLY domain containing linker protein family, member 4, mRNA (cDNA clone MGC:76157 IMAGE:5335353), complete cds
Gene Symbol: clip4
Gene ID: 394978
ORF gb_acc: MG132692
ORF ID: 9983

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064226

Library Location

Plate ID: GDExt11001
Well Location: C10

EST Sequences

Clone: MGC:76157 IMAGE:5335353
Trimmed Sequence: ATGTCTAAAAGGAAGGTCACATTTGTGGATGGGGCTGAAGACGACGATGATGAGCAGAAAAAAAAAAGGCTCCCGGATGTAGTGGGAGGCCCAGGAAGTCGATTTAAAGGGAAACATTCTCTGGACAGCGATGAGGAAGATGATGAGGAAGAAACCAGTGATGGACGTTCTGCAAAGTATGACATATTAGCCCCCGAGGATGTTGAAGGACAAGAAAACGCTACTCTGGAGTCGGAGGGTGGTGTTCCGATTACTCCTTTTAACCTGAAGGAGGAAATGGAGGAAGGGCATTTTGACTCTGAGGGCAACTATTTTTTGCGTAAAGAAGCTCAGATTCGGGACCACTGGCTTGATAATATAGACTGGGTCCGAGTTAAGGAACGCACTGCACCCACAGAAACCGCTGATGATGATGACTCTGATTCTGAGGAAGGCAGAGCACCACTGAGCAAGAAAGTGCTACTGGAGGGAATCTTGCAGCTGCTTCAGCCTGGCGAGACTGTGGCTAAAGGAATCCAGCGTCTTGGAGGGACAGGAGGCAAAAAGGCAACTGGGGGCCAGAGAGCAAGGCAGCAGAAGACCCCCCAAGGCAGGAGAAAGAAGAGAGGGACTAAGTCTGACGGAGACAGAGAGCAGGAAGATAATACAGATTCTAAAATGGATGAGGGTAAAGGTGAAACGGATTCAAGGCAAGAGAGAAAGGATGAGCAAGGTCAGGAGTCCCTAAGAGACAGGGTGCGGGATAATGGCCAAGAGGAAACTGCACAGAGCAGAGTGGCTGCGGGGTCGGAGGAAGCAAGTAACGAGGCAGAAAGTAGGCCAGAGCCCCTCGAGCTCCTCATATCCCTAGCAGATCAGATGGTAGCCCTTGGTGTGTATGAGATCTACCAGGACACATATGAGAAGGTGGCGTACAGGCTCAAGACCTTGGCTCCACCTGCCGAGCTGGACATGTTTGCTGATGAGGTGGAGGAGAAAACACTGGAGAAGAAGGCGGAGTCCCAGTCGTCGGATGCAGTGATGTGGGAGTACAAATGGGAGAACAAGGACGGAGCAGAGCTGTATGGGCCCTTCTCCAGCACACAGATGCAGGAATGGGTGGATCAGGGCTACTTCGCCGAGGGAGTTTATTGCCGGCGAGTGAGCGGCTCCGGGAGTCAGTTCTACAACTCACAGAGAATAGACTTTGAGCTTTACATGTGA
Full Trace Sequence: cgcgtctcgacgagtgcttccgaaaaacgaaaggatgtctaaaaggaaggtcacatttgtggatggggctgaagacgacgatgatgagcagaaaaaaaaaaggctcccggatgtagtgggaggcccaggaagtcgatttaaagggaaacattctctggacagcgatgaggaagatgatgaggaagaaaccagtgatggacgttctgcaaagtatgacatattagcccccgaggatgttgaaggacaagaaaacgctactctggagtcggagggtggtgttccgattactccttttaacctgaaggaggaaatggaggaagggcattttgactctgagggcaactattttttgcgtaaagaagctcagattcgggaccactggcttgataatatagactgggtccgagttaaggaacgcactgcacccacagaaaccgctgatgatgatgactctgattctgaggaaggcagagcaccactgagcaagaaagtgctactggagggaatcttgcagctgcttcagcctggcgagactgtggctaaaggaatccagcgtcttggagggacaggaggcaaaaaggcaactgggggccagagagcaaggcagcagaagaccccccaaggcaggagaaagaagagagggactaagtctgacggagacagagagcaggaagataatacagattctaaaatggatgagggtaaaggtgaaacggattcaaggcaagagagaaaggatgagcaaggtcaggagtccctaagagacagggtgcgggataatggccaagaggaaactgcacagagcagagtggctgcggggtcggaggaagcaagtaacgaggcagaaagtaggccagagcccctcgagctcctcatatccctagcagatcagatggtagcccttggtgtgtatgagatctaccaggacacatatgagaaggtggcgtacaggctcaagaccttggctccacctgccgagctggacatgtttgctgatgaggtggaggagaaaacactggagaagaaggcggagtcccagtcgtcggatgcagtgatgtgggagtacaaatgggagaacaaggacggagcagagctgtatgggcccttctccagcacacagatgcaggaatgggtggatcagggctacttcgccgagggagtttattgccggcgagtgagcggctccgggagtcagttctacaactcacagagaatagactttgagctttacatgtgattggtcccggcactctcgctgccccgcctcttccactgtgatggactctatggacttcccctgtgggacactgacacatggaagagaccattgtgtgtgctggtatatccccctgagtgccgtttgtgagcgagagaagcctcccggagtgcacactcatgctaatctggtctgtacgtgtgtgtgtgatccttacacagatttattgcagggcttcagctgtttgtaataaaaatattttatttctcttaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSKRKVTFVDGAEDDDDEQKKKRLPDVVGGPGSRFKGKHSLDSDEEDDEEETSDGRSAKYDILAPEDVEGQENATLESEGGVPITPFNLKEEMEEGHFDSEGNYFLRKEAQIRDHWLDNIDWVRVKERTAPTETADDDDSDSEEGRAPLSKKVLLEGILQLLQPGETVAKGIQRLGGTGGKKATGGQRARQQKTPQGRRKKRGTKSDGDREQEDNTDSKMDEGKGETDSRQERKDEQGQESLRDRVRDNGQEETAQSRVAAGSEEASNEAESRPEPLELLISLADQMVALGVYEIYQDTYEKVAYRLKTLAPPAELDMFADEVEEKTLEKKAESQSSDAVMWEYKWENKDGAELYGPFSSTQMQEWVDQGYFAEGVYCRRVSGSGSQFYNSQRIDFELYM
Donor tissue: tailbud