ORFeome > cops8 – XORFeome 2.0

cops8 – XORFeome 2.0

General Information

Species: Xenopus tropicalis COP9 constitutive photomorphogenic homolog subunit 8, mRNA (cDNA clone MGC:76051 IMAGE:5307219), complete cds
Gene Symbol: cops8
Gene ID: 394711
ORF gb_acc: MG132761
ORF ID: 10065

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC062497

Library Location

Plate ID: GDExt11001
Well Location: B09

EST Sequences

Clone: MGC:76051 IMAGE:5307219
Trimmed Sequence: ATGCCAGTGGCCGTGATGGCTCAAAATCCTGTGTCTTTTCAGAGGCTTCAGGAACAGTGCGAGGAACAGGAGCTTGAGGCTCCAGGAGGCATTGCCAACCCTCAGGTGTACAGCCAGCTCTTGGCATTGTACTTGCTGCATAATGACATGAATAATGCACGTTATTTATGGAAAAGAATTCCGCCAGCAATCAAATCCGCCCACTCTGAGCTTGGTGGGATCTGGGAGGTAGGACAGAAGATCTGGCAGCGAGATTTTCCAGGGATCTACACATCCATCTCTGCATGTCAGTGGTCTGAGGCCATCCAACCAGTCATGGAGGCTGTAAGAGATGCAACACGACGGCGGGCATTTGGCTTGGTTTCCCAGGCATATACTTCAATCTCTGCAGATGATTTTGCAGCTTTTGTTGGCCTTTCTGTAGAAGAGGCTGTTAAAGGAGTCATAGAACAGGGTTGGCAGGCTGATTTGGCCACTCGGATGGTAATGCCCAAAAAGCCAGATTCGGCGCCCCTGTCTTTGATCCCCAACGAACAGCAGCTGGCCAGACTTACTGACTACGTGGCTTTCCTAGAGAACTGA
Full Trace Sequence: cttgcagcgaccctaagaggtcccgggggccctgggagaagatgccagtggccgtgatggctcaaaatcctgtgtcttttcagaggcttcaggaacagtgcgaggaacaggagcttgaggctccaggaggcattgccaaccctcaggtgtacagccagctcttggcattgtacttgctgcataatgacatgaataatgcacgttatttatggaaaagaattccgccagcaatcaaatccgcccactctgagcttggtgggatctgggaggtaggacagaagatctggcagcgagattttccagggatctacacatccatctctgcatgtcagtggtctgaggccatccaaccagtcatggaggctgtaagagatgcaacacgacggcgggcatttggcttggtttcccaggcatatacttcaatctctgcagatgattttgcagcttttgttggcctttctgtagaagaggctgttaaaggagtcatagaacagggttggcaggctgatttggccactcggatggtaatgcccaaaaagccagattcggcgcccctgtctttgatccccaacgaacagcagctggccagacttactgactacgtggctttcctagagaactgaagttccctcctatttctagatcaaaaggcgcagacacaggaggctggcaaagtggcaaaatcttttgcacctccaaacccacccctggtcattgaactctttctctgctgtgtgagctgatgtcttttggagctgaaaagggttaatgcaaatggagatctggagcattctgttagcttgggtgctgtgtatgttaacccctttgacaataaaatggttaagatactgcataatcttttatgaaaattgctctttagttttataccataaatgtgggttgcttattatacatgtaagagttaataccagtgaattgcatagtgagacttgctcttacggccgaggaggtgaatttttttttccagtctgaactccatgaataaataagaaaatcatatgctgctccacagtaaatatagacctgtgtcatatttggtaagctgttttcaaggttggaattcatctgggagagggattatgatgtgagcttctggcagttctcaaactgtgagactgagacccaatgacagtccggtgtaaatgtgctggtcataaacaggttaaattacactgctgctttgatttaaaaggatatttgctatctattttaatcaagcagatgttaaactacaactttaaacagaacttaagcacatatatgttgatgggatgcaggaagatgtggttcaacaatattgagggatgtggttgcctgtctctaaaaaaaaaaaaaaaaaa
Translation: MPVAVMAQNPVSFQRLQEQCEEQELEAPGGIANPQVYSQLLALYLLHNDMNNARYLWKRIPPAIKSAHSELGGIWEVGQKIWQRDFPGIYTSISACQWSEAIQPVMEAVRDATRRRAFGLVSQAYTSISADDFAAFVGLSVEEAVKGVIEQGWQADLATRMVMPKKPDSAPLSLIPNEQQLARLTDYVAFLEN
Donor tissue: gastrula