ORFeome > cradd – XORFeome 2.0

cradd – XORFeome 2.0

General Information

Species: Xenopus tropicalis CASP2 and RIPK1 domain containing adaptor with death domain, mRNA (cDNA clone MGC:89035 IMAGE:7005080), complete cds
Gene Symbol: cradd
Gene ID: 448758
ORF gb_acc: MG134147
ORF ID: 11777

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC075346

Library Location

Plate ID: GDExt11017
Well Location: E03

EST Sequences

Clone: MGC:89035 IMAGE:7005080
Trimmed Sequence: ATGGATCCTAGGCATAAGGAACTACTCAGAAGGCAGCGCCTAGAGCTCTGTGCTGAGGGCCTTGCAGAAGGACTGGTCCCACAGTATCTACTACAAGAAGGAATCATCACAGAAAGCCAATTAGAGGAAGTCAGCTCTCAAGTCACCAGCCACAGACGAGCCATGAAGCTTCTAGACATTCTTCCTACCCGTGGGCCAAGAGCGTTTGAGGTTTTCCTGGATTCCTTAAGTGAATTTCCGTGGATGCGTGAGAACTTGATGAAACTTAGTCAAGATGGTGTAGACATTCCAGGAGGAAGGACGCCGGAGTTGCCATCTAAATTCCATCACAGCTGTCCAACTGAAAAGCAATTGAACCTCCTGGCAGGGAAGTTGGGGCCAGAGTGGGAGCAGATACTTGTGCATCTTGGCTTGGACCACAATGACCTGTACAGGTGTAAGGAACAGAATCGTTATAATCTTCAGTCGCAAATCGTGGAAGGTTTTGTGAAGTGGAAACAGCGGATGGGAAGCAAAGCCACAATGTTGCAGCTATGGCAAGCGCTACAAGCAGCAGAGGCAGATTTGTCCGTAATGCAGCAAATCCTACAGTGA
Full Trace Sequence: tgtgagtctcctcagtgccggctccttcccaccaacgccagactctatgggaccccatggcctccttccctgacagtctctgtgctgcggacacttccctgcccggctgagggcaatgcgcctcccttaataacctcgccgagcaacaccttcatgcaggatttttcttgaatcttaagtgatggatcctaggcataaggaactactcagaaggcagcgcctagagctctgtgctgagggccttgcagaaggactggtcccacagtatctactacaagaaggaatcatcacagaaagccaattagaggaagtcagctctcaagtcaccagccacagacgagccatgaagcttctagacattcttcctacccgtgggccaagagcgtttgaggttttcctggattccttaagtgaatttccgtggatgcgtgagaacttgatgaaacttagtcaagatggtgtagacattccaggaggaaggacgccggagttgccatctaaattccatcacagctgtccaactgaaaagcaattgaacctcctggcagggaagttggggccagagtgggagcagatacttgtgcatcttggcttggaccacaatgacctgtacaggtgtaaggaacagaatcgttataatcttcagtcgcaaatcgtggaaggttttgtgaagtggaaacagcggatgggaagcaaagccacaatgttgcagctatggcaagcgctacaagcagcagaggcagatttgtccgtaatgcagcaaatcctacagtgatatttgggaactaatgcttatctaatcaaactttaggcaaaatgtgcctgtaacccacagctattagtctgctttaactgaactaaacgccaataggcattactaggttgttcggagaaaacttggatcatgatcataaccgtctctgtgaaaacaataatcactctctcccactgatacttgtgtaagaacatatttgaattattacccatgctcctctgtcctatctatctatctatctatctatctatctatctgtctgtctgtctgtctgtctgtcttcctcaggcatatgcatcccattttttatacactgtacaagaagctagcaggtggtcagtagcagatagcagtaggtaacaggaaccagggctgtggagtcggtagataaattctccgactccgactcctcagtttctgatacttcggactccgactccacgactccgactcctctgtttttaatatgctaatgtattttatacattcatacagtcaatgaaaagcatgcttcatggtcactcaacgtgttcgtttatgcactgtgtgcattgggctttattcttatagcagagaagtaattaattatgactgtttgtgaattgggacatttaaacttgcttaatttttttttattcccatttaaatttagtaggagtcggagtcagagttggttcattttttgccgactccgactccaggtacccaaaattgcctccgactcagactccacagccctgacaggaacaatgccttacatttactcataacctgtacagagagatattataaaccaattcaagcttaggaattcccctgtactgaattgaaaattggcagccctttgaagtgatagtatatgtctatgtacacctctgtgcaacatgatcacattaaatagaacttgtagtaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MDPRHKELLRRQRLELCAEGLAEGLVPQYLLQEGIITESQLEEVSSQVTSHRRAMKLLDILPTRGPRAFEVFLDSLSEFPWMRENLMKLSQDGVDIPGGRTPELPSKFHHSCPTEKQLNLLAGKLGPEWEQILVHLGLDHNDLYRCKEQNRYNLQSQIVEGFVKWKQRMGSKATMLQLWQALQAAEADLSVMQQILQ
Donor tissue: