ORFeome > crisp2 – XORFeome 2.0

crisp2 – XORFeome 2.0

General Information

Species: Xenopus tropicalis crisp2 protein, mRNA (cDNA clone MGC:79607 IMAGE:6979431), complete cds
Gene Symbol: crisp2
Gene ID: 493566
ORF gb_acc: MG133634
ORF ID: 11179

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC080935

Library Location

Plate ID: GDExt11011
Well Location: C10

EST Sequences

Clone: MGC:79607 IMAGE:6979431
Trimmed Sequence: ATGATGCTGATTGGTGCCCTGTGTATTGCGGCATTCATGGCACTCGCAGTTGAGTCGGCGGATCCCCCGTTTTCCTCAATATCGACTGATAATGTCACCGTCACTCAGATCATTATTAATGCCCACAATAACTACAGGAGAAATGCCTCTCCCTCTGCACGGAACATGCTGAAAATGGTGTGGAACAAAGATGCGGCCATAAATGCAGCCAGTTGGGCAGCGACGTGCAGCGAGTCCCATAGCCCCTCGGATAAACGCACCATTCCTGGCTTTGGCTGTGGGGAAAACCTGTACATGGCTTCCTATCCAGCCTCTTGGGAGGAGGCAGTTAAAGGGTGGTACAGCGAATATAATGACTTTCAGTATGGAGTGGGGCCTAAATCCCCCGGTCTGGTTACGGGACATTATACCCAGGTCATGTGGTACAATTCATACATGGTGGGATGCAGCGTCTCCTACTGCCCTAAAAGCCCTTACAAATACTTCTATGTTTGCCAGTACTGCCCAGCGGGAAACCTTGACAGCACAATGAGCACCCCGTATAAAACTGGCCCAAAGTGCGCAGACTGTCCGACAGCCTGTGATAATGGCCTTTGCACCAATTACTGTCCCTATCAAGATTTATATTCCAATTGCAAGACTTACGCTTCTTATTGCAATACTTTTCCTACAATAAGAGACGGCTGCAAGGCTACCTGTCTCTGCACCAATCAGATCATCTGA
Full Trace Sequence: cagactcccagcagaacctgctcccacacacaggaaaatgatgctgattggtgccctgtgtattgcggcattcatggcactcgcagttgagtcggcggatcccccgttttcctcaatatcgactgataatgtcaccgtcactcagatcattattaatgcccacaataactacaggagaaatgcctctccctctgcacggaacatgctgaaaatggtgtggaacaaagatgcggccataaatgcagccagttgggcagcgacgtgcagcgagtcccatagcccctcggataaacgcaccattcctggctttggctgtggggaaaacctgtacatggcttcctatccagcctcttgggaggaggcagttaaagggtggtacagcgaatataatgactttcagtatggagtggggcctaaatcccccggtctggttacgggacattatacccaggtcatgtggtacaattcatacatggtgggatgcagcgtctcctactgccctaaaagcccttacaaatacttctatgtttgccagtactgcccagcgggaaaccttgacagcacaatgagcaccccgtataaaactggcccaaagtgcgcagactgtccgacagcctgtgataatggcctttgcaccaattactgtccctatcaagatttatattccaattgcaagacttacgcttcttattgcaatacttttcctacaataagagacggctgcaaggctacctgtctctgcaccaatcagatcatctgatttcagccctgtggccggggcttggattgggactgaacacaacggaaataattcgaataatgatataattaaagaccatttttttcttgtcacaattggtgtactttataaaaatgtatgtaatagaacgtcagctcttatacacagatatatatatggttgtgttttatttatactttatttattgtgttttgggtgcacaaaacaaacagccaatagcagacaatggtctcgccctgcaacattctcacgtctgtcagccccaaaccagctatgttactattttagcccttgcacttgggcttgcattcctaaataagccttttgaactcaaaaactaaacaaaaacttttttttattattattagtcaacaagcagcctaaaatgcacatatagtgctgactaaggtagaagaaatgaaggagcttagcggtgtggggttggccccttgggacttggagcaggggccagtggggctcagtcaaaattatagttatcggaccccttatccggaaagaaattatccagaaagttctgaattacggaatggccatctcccatatactccattttaatgaaataatgcacatttttctctgtaataataaaacagtacctgtacttgatcccaaaaaaaaaaaaaaaaaaa
Translation: MMLIGALCIAAFMALAVESADPPFSSISTDNVTVTQIIINAHNNYRRNASPSARNMLKMVWNKDAAINAASWAATCSESHSPSDKRTIPGFGCGENLYMASYPASWEEAVKGWYSEYNDFQYGVGPKSPGLVTGHYTQVMWYNSYMVGCSVSYCPKSPYKYFYVCQYCPAGNLDSTMSTPYKTGPKCADCPTACDNGLCTNYCPYQDLYSNCKTYASYCNTFPTIRDGCKATCLCTNQII
Donor tissue: tailbud