ORFeome > crisp3 – XORFeome 2.0

crisp3 – XORFeome 2.0

General Information

Species: Xenopus tropicalis cysteine-rich secretory protein 3, mRNA (cDNA clone MGC:76177 IMAGE:5335665), complete cds
Gene Symbol: crisp3
Gene ID: 394939
ORF gb_acc: MG132693
ORF ID: 9984

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064231

Library Location

Plate ID: GDExt11001
Well Location: C11

EST Sequences

Clone: MGC:76177 IMAGE:5335665
Trimmed Sequence: ATGATGCTGATTGCTGTCCTCTGTCTCTCAGTCTTGCAGCGAGCAAGTGCGGCAGCCGTGTTTCCCTTCTCCTCACTATCAACACGTTACGCTACAAACAGGCAGAAGATCGTTGATATCCACAATGCCTACAGGAGAAGCGCCAACCCAACTGCATCCAACATGCTGAAAATGAGTTGGAGCATTGAGGCCGAAAACAATGCAAAGAATTGGGCAACTACATGCAATCAGTATCACAGTCAACCGGCTGCCCGGCAGATTGCCAATATCACCTGCGGGGAAAATCTGTTCATGTCGTCCTACCCGGCCTCTTGGGAGGAGGTGATCCAATCGCTTCACAGTGAATATGACAATTTTGAATACGGAGTAGGAGCCAAGGCGGTTGGTCTCGTCATTGGGCATTATACCCAGGTTATGTGGTACAAATCCTACCGGATTGGATGTTATTGCACAGAATGCCCCAACGATGGCGTCAGGTTGAAATACTACTACGTTTGTCAGTACTACCCGGCAGGAAATTATGCTGACAGAATAAATTATCCATACAAATCTGGCCCGAGCTGCGCAGACTGCCCAGACGCATGTGATAACGGACTATGCACCAATCCCTGCCCGTATGAAGATCAATATAGCAACTGCGATGATTTGGCATCTGGAGATCAATGTGATACATACCAAATAGTAAAGGAAGGTTGCCCGGGTTCCTGTCTCTGCAAAAACAATGAGATAATATAA
Full Trace Sequence: gacagaaggaaacaggaaaaatgatgctgattgctgtcctctgtctctcagtcttgcagcgagcaagtgcggcagccgtgtttcccttctcctcactatcaacacgttacgctacaaacaggcagaagatcgttgatatccacaatgcctacaggagaagcgccaacccaactgcatccaacatgctgaaaatgagttggagcattgaggccgaaaacaatgcaaagaattgggcaactacatgcaatcagtatcacagtcaaccggctgcccggcagattgccaatatcacctgcggggaaaatctgttcatgtcgtcctacccggcctcttgggaggaggtgatccaatcgcttcacagtgaatatgacaattttgaatacggagtaggagccaaggcggttggtctcgtcattgggcattatacccaggttatgtggtacaaatcctaccggattggatgttattgcacagaatgccccaacgatggcgtcaggttgaaatactactacgtttgtcagtactacccggcaggaaattatgctgacagaataaattatccatacaaatctggcccgagctgcgcagactgcccagacgcatgtgataacggactatgcaccaatccctgcccgtatgaagatcaatatagcaactgcgatgatttggcatctggagatcaatgtgatacataccaaatagtaaaggaaggttgcccgggttcctgtctctgcaaaaacaatgagataatataaccatttccctaggcttcccaaccctttataactactgtatgcctgtgtaatatctactggctagatactggggttttctggataatggatctttacataatttggatcaccaaaccttactgtcatgatatttatggggtactttttatttctaaatgacactgttacacagcaaataattccctctgccatttaacattttattcttgtaccaacaaatgtatttgtagctgtaatattggtgtgtaggcgccatctcagtgccttgtgcctgagtctgagctttcagccagcgctacacattagaactgctttcagctaacctattgtttctcctactcccatgtaactggaggagtcccaagccggatttggatttcttactattgagtgctattctgatacctactgggagctgctatcttgctcccttcccattgttctgctgatcggctgctgggggtgagggggggggggatatcactccaacttgcagcgcagcagtaaagtgtgactgaagtttatctgagcacaaatcacatgactgtggcaccctgggaaaggaagaataagactatccggctaagggatcccatagccttcttttttactcatgttccctaatttcattataaaggggagctattattttaatataatggaatattttgcttgttacattgttaactattaattagaacacaaataaatacatgactataaatatttaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MMLIAVLCLSVLQRASAAAVFPFSSLSTRYATNRQKIVDIHNAYRRSANPTASNMLKMSWSIEAENNAKNWATTCNQYHSQPAARQIANITCGENLFMSSYPASWEEVIQSLHSEYDNFEYGVGAKAVGLVIGHYTQVMWYKSYRIGCYCTECPNDGVRLKYYYVCQYYPAGNYADRINYPYKSGPSCADCPDACDNGLCTNPCPYEDQYSNCDDLASGDQCDTYQIVKEGCPGSCLCKNNEII
Donor tissue: tailbud