ORFeome > ctss – XORFeome 2.0

ctss – XORFeome 2.0

General Information

Species: Xenopus tropicalis cathepsin S, mRNA (cDNA clone MGC:88875 IMAGE:6998140), complete cds
Gene Symbol: ctss
Gene ID: 448203
ORF gb_acc: MG134060
ORF ID: 11679

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC075261

Library Location

Plate ID: GDExt11016
Well Location: A05

EST Sequences

Clone: MGC:88875 IMAGE:6998140
Trimmed Sequence: ATGAAATCCCTTATTTTTCTGGCGACTGTTTTGGCAGCCATAGTCAAAGCTCGGATTAACCCTGCACTTGATAACCACTGGCTGCTGTGGAAGAACACACATAACAAAGATTATGAAGATGAGATAGAGGACCTCCAAAGACGAATTACTTGGGAAAAGAACCTTAATTTGGTCAATATGCATAACCTGGAGTATTCGATGGGCATGCACACCTATGAGCTGGGAATGAACCATCTTGCCGATATGACTAGTGAGGAAATCAAGTCTAAGCTGACTGGCTTAATACTACCTCCCCAAAGTGAGAGGCAGGCCACATTTAGTAGCCAAAAGAATAGCACTTTTGGAGGTAAAGTACCAGACTCCATCGATTGGAGGGATAAAGGATGCGTTAGTGATGTAAAAAACCAGGGAGGATGTGGTTCTTGCTGGGCCTTTAGTGCAGTTGGGGCCTTGGAGGGACAGCTGATGCTTAAAACAGGAAAACTGGTTTCTCTCAGCCCACAGAACCTTGTAGACTGTTCATCAAAATATGGGAACAAGGGCTGCGGCGGGGGCTTTATGACGCAAGCTTTCCAGTATGTCATTGACAATAAAGGCATTGATTCTGATAGCTATTATCCTTATCATGCCATGGATGAAAAGTGTCATTATGATCCTACTGGCAAAGCTTCCACATGTGCTAAATACACAGAGATTGTTCCTGGCACAGAAGACAACCTCAAGCAAGCCCTAGGCAGTATTGGTCCAATATCAGTTGCTATAGATGGGACCCGCCCTTCTTTCTTTCTTTACAGAAGTGGTGTCTACAGTGATCCAACCTGCTCTCATGAAGTTAACCATGGCGTCCTTGCAGTTGGCTATGGAAATCTCAATGGACAGGATTTCTGGCTTCTAAAAAACAGCTGGGGTACAAAGTATGGAGACCAAGGATACGTCCGCATTGCAAGGAACAAAGGCAATCTGTGTGGAGTGGCTAGTTACACATGCTACCCGGAAATATAA
Full Trace Sequence: cttctctacttggtctccgacagtttcacccatttcgaagcataaaaaagggggtcgcaaagagtagccggcagagtaaggatgaaatcccttatttttctggcgactgttttggcagccatagtcaaagctcggattaaccctgcacttgataaccactggctgctgtggaagaacacacataacaaagattatgaagatgagatagaggacctccaaagacgaattacttgggaaaagaaccttaatttggtcaatatgcataacctggagtattcgatgggcatgcacacctatgagctgggaatgaaccatcttgccgatatgactagtgaggaaatcaagtctaagctgactggcttaatactacctccccaaagtgagaggcaggccacatttagtagccaaaagaatagcacttttggaggtaaagtaccagactccatcgattggagggataaaggatgcgttagtgatgtaaaaaaccagggaggatgtggttcttgctgggcctttagtgcagttggggccttggagggacagctgatgcttaaaacaggaaaactggtttctctcagcccacagaaccttgtagactgttcatcaaaatatgggaacaagggctgcggcgggggctttatgacgcaagctttccagtatgtcattgacaataaaggcattgattctgatagctattatccttatcatgccatggatgaaaagtgtcattatgatcctactggcaaagcttccacatgtgctaaatacacagagattgttcctggcacagaagacaacctcaagcaagccctaggcagtattggtccaatatcagttgctatagatgggacccgcccttctttctttctttacagaagtggtgtctacagtgatccaacctgctctcatgaagttaaccatggcgtccttgcagttggctatggaaatctcaatggacaggatttctggcttctaaaaaacagctggggtacaaagtatggagaccaaggatacgtccgcattgcaaggaacaaaggcaatctgtgtggagtggctagttacacatgctacccggaaatataagggtgcttgccagaaccacaataaggagcaataaaggatctttgctcacttttacttttatatcttagacctaatgaaacagcgacagggcacacttgcacatattcatataaaataactgatcctttgattaacttgatatgacctcttagaggtcgcccaatagtgtccttggccaggttttaaccaagaaaaatgcccatagactccaatggatgaaaaaaaaatagtagtttaaaaaaacacccattgacttttaatgcattttgcgtctttttgccgtttcacgaatttttcagagaagcaaaatgggacaggttcactcatcactagttatacatttgtatttacagcaaaacagctaacattcaccggaagcctcgcggaggcacagagccaggggacaacaaatactgatacacactgaaactgggcctttgttagtgactaaggctacattatatgcactgggcttttaagggctattaaatgttatttttttagtgctacacctactgtaaaactattggtatttgggtttatctgggggcatttgctgcaacataggcaagagggtattcttaaaaattttagactcttgtaattctattttttttcctcatcaatattaatgtacaatttctgatttggaataaatgatctaataggaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MKSLIFLATVLAAIVKARINPALDNHWLLWKNTHNKDYEDEIEDLQRRITWEKNLNLVNMHNLEYSMGMHTYELGMNHLADMTSEEIKSKLTGLILPPQSERQATFSSQKNSTFGGKVPDSIDWRDKGCVSDVKNQGGCGSCWAFSAVGALEGQLMLKTGKLVSLSPQNLVDCSSKYGNKGCGGGFMTQAFQYVIDNKGIDSDSYYPYHAMDEKCHYDPTGKASTCAKYTEIVPGTEDNLKQALGSIGPISVAIDGTRPSFFLYRSGVYSDPTCSHEVNHGVLAVGYGNLNGQDFWLLKNSWGTKYGDQGYVRIARNKGNLCGVASYTCYPEI
Donor tissue: