ORFeome > cyct – XORFeome 2.0

cyct – XORFeome 2.0

General Information

Species: Xenopus tropicalis cyct protein, mRNA (cDNA clone MGC:89066 IMAGE:7005766), complete cds
Gene Symbol: cyct
Gene ID: 493538
ORF gb_acc: MG134119
ORF ID: 11745

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC082495

Library Location

Plate ID: GDExt11017
Well Location: G07

EST Sequences

Clone: MGC:89066 IMAGE:7005766
Trimmed Sequence: ATGGGGGACGTTGAAAAGGGAAAGAAGATCTTTGTCCAGAAGTGCGCACAGTGCCACACAGTCGAAAAGACTGGAAAACATAAGACTGGGCCGAACCTGTGGGGCCTCTTCGGCCGTAAAACTGGACAAGCCCCAGGATTTTCTTACACTGATGCAAACAAAAGCAAAGGCATTGTCTGGGGAGAAGATACCCTGTTTGAATATTTGGAGAACCCAAAGAAATATATTCCTGGAACCAAAATGATTTTTGCTGGCATTAAAAAGAAGAATGAGCGCGCAGATCTGATAGCCTATCTAAAGAAGTCCACGTCAGAGTGA
Full Trace Sequence: ttagagtaacgcgtagaggcggcgctgggagccgtagctgtagtgggtacccggtgagctgtgagagacattatccggctacaaaatgggggacgttgaaaagggaaagaagatctttgtccagaagtgcgcacagtgccacacagtcgaaaagactggaaaacataagactgggccgaacctgtggggcctcttcggccgtaaaactggacaagccccaggattttcttacactgatgcaaacaaaagcaaaggcattgtctggggagaagataccctgtttgaatatttggagaacccaaagaaatatattcctggaaccaaaatgatttttgctggcattaaaaagaagaatgagcgcgcagatctgatagcctatctaaagaagtccacgtcagagtgatccgcagcacaggactgtgttttaatgaatggaccttcagctggattccactcgggcttgtgttacgtgtgcatcttactaaccagagactccaataaacaggaatgttggcagggctatgcatggacattacctgtggtggtttatttattcataattacaaagaaaataatgcaaactctttagatggatgtagcattgtgtactgcaaacagcctgagcttaacctgatccacttctctgtgcttatagtggcccctggtctcacttctgtgggtttaattatttattatatggcattctataatggagtgagtgaaatcacattgtttttgtaaagttacagaacttgtgcatttgcagtaccctgtgctacgtctgtgtatgacttttaggggctttgctgttaatggtagagtaatactattagaaggcatactactaaacagatgcatctatacttttattcccgttatattaaagtctaaaaggagcagcagtaatataaaagggctgtatttacacttcagaataacataccttgctttttttatttttatctgtgctttcagtggagtggttcccaaactatagggctgtctggagcagcggcccagcataaggttattagggtcagatttgcagagcatgtcaggttgttatcctatatatgcctgcaagccctaagggttgaacacttatttgctgcacttgatataactgataaagccatgcatttacatatatgtctgtaacgctgttattagctaaggctgggtgggctgcctaaaggatgacctccatgtcagtaaacagatttgcagcaataaagccagccagtaagatcctgtagagttactcagcccattttgcctagcagataataggtgaaaatggtgataaatttgtgtcaaataatattattgttctctttacatctgtggtaaaaggagctaatacataataagacaatgccagttttcattgaatttgcatattaaagatagataaccctatgttaatctttcaatatatattcataaggtttttttttttgtttttttttactttttggtgttactgtcctattaagaactactgacacatgggtttctgttgcaacaatgaatatctcaacatttgtcattggtgtagagcataaaatgtagcacaaattaaagctgtggtcatttttacaaaccaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MGDVEKGKKIFVQKCAQCHTVEKTGKHKTGPNLWGLFGRKTGQAPGFSYTDANKSKGIVWGEDTLFEYLENPKKYIPGTKMIFAGIKKKNERADLIAYLKKSTSE
Donor tissue: