ORFeome > dgat2 – XORFeome 2.0

dgat2 – XORFeome 2.0

General Information

Species: Xenopus tropicalis diacylglycerol O-acyltransferase homolog 2, mRNA (cDNA clone MGC:76066 IMAGE:5307588), complete cds
Gene Symbol: dgat2
Gene ID: 395003
ORF gb_acc: MG132737
ORF ID: 10037

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064191

Library Location

Plate ID: GDExt11001
Well Location: C05

EST Sequences

Clone: MGC:76066 IMAGE:5307588
Trimmed Sequence: ATGAAGACTATCATTGCTGCTTACTCGGGGGTCTTACGCGGCACTGGGTCCAGTCTCCTATCAGCGGTACATGACCTTCCAAATATCCCCTGGCTGTCCAAATCAAGTGTGGTGAGACATCTTCAGATCATCTCTGTCCTACAATGGGTTCTCAGCTTCCTCATATTGGGTGTGGCGTGCACTGCAGTACTGGTGTACATCTTCTGCACTGACCTCTGGCTGATTGCAGCTTTGTATCTGACATGGATGGTGCTTGACTGGAATACACCATATAAAGGTGGCAGGCGATCCTCATGGGTACGGAACTGGGCAGTCTGGCGCTACTTCAGAGACTATTTTCCAATAAAGTTGGTAAAAACGCACAACCTCCTGCCAAGCAGAAACTATATCTTCGGGTATCACCCCCATGGAATAATGTGCCTTGGAGCATTTTGTAACTTTGGAACAGAAGCCACTGGTGTGTCCAAAAAGTTTCCTGGAATTAAGTGTCACCTGGCCACATTAGCTGGAAACTTCAGAATGCCTGTACTGAGGGAATATTTAATGTCCGGAGGTATATGCCCCGTGGCCCGGGATACCATTGACTACATTCTGTCCAAGAACGGAACTGGAAATGCTGTGGTTATTGCAGTTGGGGGAGCCGCAGAATCCCTTAACTGCAGACCTGGGAAAAACACTGTAACGCTCAAGCAGAGAAAAGGATTTGTGAAAGTTGCACTGCAGCATGGAGCTGATCTTGTTCCTGTCTACTCATTTGGCGAAAATGAAGCTTACAAGCAGGTCGTCTTTGAGGAGGGGTCTTGGGGAAGATGGATACAGAAGAAGTTTCAGAAATATGTTGGTTTTGCCCCATGTCTCTTCCATGGGTGCAGCTTCTTCTCCTCTAACAGCTGGGGGTTGGTTCCGTATGCCAATCCAATAACAACTGTTGTTGGAGAACCAATCACCGTTCCCAAGATCGAACAACCCACCCAGAAAGATGTTGAACTTTATCACGCCATGTACGTGACATCCCTGCAGCGGCTTTTTGACAAGTACAAAACTAAGCTTGGTCTCCACGATTCAGAAATGCTGGAAATTGTCTGA
Full Trace Sequence: ggagctgggatcggtacctggctgcggtgaggcactggcctggcaacatgaagactatcattgctgcttactcgggggtcttacgcggcactgggtccagtctcctatcagcggtacatgaccttccaaatatcccctggctgtccaaatcaagtgtggtgagacatcttcagatcatctctgtcctacaatgggttctcagcttcctcatattgggtgtggcgtgcactgcagtactggtgtacatcttctgcactgacctctggctgattgcagctttgtatctgacatggatggtgcttgactggaatacaccatataaaggtggcaggcgatcctcatgggtacggaactgggcagtctggcgctacttcagagactattttccaataaagttggtaaaaacgcacaacctcctgccaagcagaaactatatcttcgggtatcacccccatggaataatgtgccttggagcattttgtaactttggaacagaagccactggtgtgtccaaaaagtttcctggaattaagtgtcacctggccacattagctggaaacttcagaatgcctgtactgagggaatatttaatgtccggaggtatatgccccgtggcccgggataccattgactacattctgtccaagaacggaactggaaatgctgtggttattgcagttgggggagccgcagaatcccttaactgcagacctgggaaaaacactgtaacgctcaagcagagaaaaggatttgtgaaagttgcactgcagcatggagctgatcttgttcctgtctactcatttggcgaaaatgaagcttacaagcaggtcgtctttgaggaggggtcttggggaagatggatacagaagaagtttcagaaatatgttggttttgccccatgtctcttccatgggtgcagcttcttctcctctaacagctgggggttggttccgtatgccaatccaataacaactgttgttggagaaccaatcaccgttcccaagatcgaacaacccacccagaaagatgttgaactttatcacgccatgtacgtgacatccctgcagcggctttttgacaagtacaaaactaagcttggtctccacgattcagaaatgctggaaattgtctgaatttgtaccctttgcattctgttatgtgctttctgtgacatgtaccctgactgtaataggggagagaactatatttttgacaatttgttgctagcaatcacacctgtatgaggtggaattctgaggtatgttcatttgctgaaaccagctgctgtatcgagtctagtactttaggctatgctctctacagaactggttttcatgatgacggaagttgttgtgatgggtctgccacctgccttctgtacagatatagtcttggggatcttgctaaaccatgtttctgccgccacatttgtgacctgctaaaagtaaaaagtacacatgtagatttgtttatggcccagtctatagtagaacatatctcctacgtgtgagtcttctgaaagctttaacttactttgctccatccaaatgcagttgcgcagccagagattcagataaaggcctcgccatttctacacttcacccaatatacaatgtacataatctcactattcctccaactgtctggaaataaagtaatattagggtgaagacgtacagagctgatcatttactgataattgcctctgcaaaaaaagacagttatcagtattgtctatggcagagtagttcctggcatttagtagctgctactaagtagctctgtatgtcttcacccttatcctgctgtcacaacttggttccttgtccagttacaagctgttcccagtctgggcttttgtaaaaaaaaaaaaaaataaacaacaatgaaaaaaaaaataaaaaaaaaaaaaaaaaaa
Translation: MKTIIAAYSGVLRGTGSSLLSAVHDLPNIPWLSKSSVVRHLQIISVLQWVLSFLILGVACTAVLVYIFCTDLWLIAALYLTWMVLDWNTPYKGGRRSSWVRNWAVWRYFRDYFPIKLVKTHNLLPSRNYIFGYHPHGIMCLGAFCNFGTEATGVSKKFPGIKCHLATLAGNFRMPVLREYLMSGGICPVARDTIDYILSKNGTGNAVVIAVGGAAESLNCRPGKNTVTLKQRKGFVKVALQHGADLVPVYSFGENEAYKQVVFEEGSWGRWIQKKFQKYVGFAPCLFHGCSFFSSNSWGLVPYANPITTVVGEPITVPKIEQPTQKDVELYHAMYVTSLQRLFDKYKTKLGLHDSEMLEIV
Donor tissue: gastrula