ORFeome > dhps – XORFeome 2.0

dhps – XORFeome 2.0

General Information

Species: Xenopus tropicalis deoxyhypusine synthase, mRNA (cDNA clone MGC:76269 IMAGE:5379238), complete cds
Gene Symbol: dhps
Gene ID: 394501
ORF gb_acc: MG132775
ORF ID: 10089

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061622

Library Location

Plate ID: GDExt11002
Well Location: C05

EST Sequences

Clone: MGC:76269 IMAGE:5379238
Trimmed Sequence: ATGGCAGAGGGCCTTCCCAATGATGCCAAGGGGGCAGTGTTGATGCCCAGCGACTCCCTACCAGAGGGCTCCGTTCAGGTCAGAGGATATGACTTTAACCGTGGAGTCAACTATGAAGCTTTGCTGCAGAGCTACCTGACTACAGGCTTCCAGGCCACACACTTTGGGCAAGCGGCCAAAGAGATCAACAACATGATAGAGGCGAAGCTGGCATCTCCCGGAGGCTGCACCATTTTTCTTGGATACACATCCAACCTGATCAGCTCCGGAGTACGAGAAACTATACGGTACCTGGTGGAGCACAGCATGGTGGATATTGTAGTCACAACGGCCGGGGGAATTGAAGAGGACTTGATTAAATGCCTGGCACCAACGTACCTGGGAGACTTTAGCCTGAAGGGGGCAGACCTGAGGCCTCGGGGAATAAACCGGATCGGTAATCTCTTGGTTCCAAACAATAATTACTGTTTATTTGAGGACTGGGTCACCCCGATCCTGGATCAGATGGTGTTGGAGCAAGATACCGAGGGCACCAAGTGGACTCCCTCTAAGATGATTGCTCGTCTAGGAAAGGAGATCAACCACCCAGACTCTGTGTATTACTGGGCCTATAAGAACAACATCCCAGTGTTTAGCCCTGCGCTGACAGATGGATCTCTTGGAGATATGATGTATTTTCACTCATACAAAAATCCTGGCCTCAAACTGGACATTGTTGAGGATATACAGAAGTTGAACTCCAATGTAATCTTTGCAAAGAAGACAGGAATGATTATCTTGGGTGGGGGACTTATCAAACACCACATCTGCAATGCTAACCTCATGAGGAACGGAGCAGATTATGCAGTTTATGTGAACACAGCTCAGGAGTTTGATGGGTCGGACGCTGGTGCGAGGCCGGATGAAGCCGTGTCATGGGGCAAAATCCGTATGGAGGCAAAACCAGTCAAGATCTACGCCGAAGCCACCCTGGTCTTCCCTTTGCTCGTGGCTCAGACTTTCGCACAGAAACAGGCAGATTTCCCTGCCAAAAAGCAAGAACAGGATTAA
Full Trace Sequence: gaagcaagaggtttccaacaacataatggcagagggccttcccaatgatgccaagggggcagtgttgatgcccagcgactccctaccagagggctccgttcaggtcagaggatatgactttaaccgtggagtcaactatgaagctttgctgcagagctacctgactacaggcttccaggccacacactttgggcaagcggccaaagagatcaacaacatgatagaggcgaagctggcatctcccggaggctgcaccatttttcttggatacacatccaacctgatcagctccggagtacgagaaactatacggtacctggtggagcacagcatggtggatattgtagtcacaacggccgggggaattgaagaggacttgattaaatgcctggcaccaacgtacctgggagactttagcctgaagggggcagacctgaggcctcggggaataaaccggatcggtaatctcttggttccaaacaataattactgtttatttgaggactgggtcaccccgatcctggatcagatggtgttggagcaagataccgagggcaccaagtggactccctctaagatgattgctcgtctaggaaaggagatcaaccacccagactctgtgtattactgggcctataagaacaacatcccagtgtttagccctgcgctgacagatggatctcttggagatatgatgtattttcactcatacaaaaatcctggcctcaaactggacattgttgaggatatacagaagttgaactccaatgtaatctttgcaaagaagacaggaatgattatcttgggtgggggacttatcaaacaccacatctgcaatgctaacctcatgaggaacggagcagattatgcagtttatgtgaacacagctcaggagtttgatgggtcggacgctggtgcgaggccggatgaagccgtgtcatggggcaaaatccgtatggaggcaaaaccagtcaagatctacgccgaagccaccctggtcttccctttgctcgtggctcagactttcgcacagaaacaggcagatttccctgccaaaaagcaagaacaggattaaactccctctggccttatggccagagcttgggtctgtgccgtggcttggccttccccagtgcatacaaactatgcatgttctgcctcgtggcaaaccgccatgtctcttggcaagagttctagttctagatctcgttagcctgcctttctagaatgagtgcaatggtagatgtaccgtatgctcttgtgttgtacataagtttacatgtgtagggggtcgttatttaatcggtgaggggtgggtcagtagtgataacccctacgtgttcttggctgctgtcatttgtattttatgttgtctatttaagttttatttttgtgaatgaaggcgcgaccccactatttcaagggttgaaataaaaaaaaaaaaaaaaa
Translation: MAEGLPNDAKGAVLMPSDSLPEGSVQVRGYDFNRGVNYEALLQSYLTTGFQATHFGQAAKEINNMIEAKLASPGGCTIFLGYTSNLISSGVRETIRYLVEHSMVDIVVTTAGGIEEDLIKCLAPTYLGDFSLKGADLRPRGINRIGNLLVPNNNYCLFEDWVTPILDQMVLEQDTEGTKWTPSKMIARLGKEINHPDSVYYWAYKNNIPVFSPALTDGSLGDMMYFHSYKNPGLKLDIVEDIQKLNSNVIFAKKTGMIILGGGLIKHHICNANLMRNGADYAVYVNTAQEFDGSDAGARPDEAVSWGKIRMEAKPVKIYAEATLVFPLLVAQTFAQKQADFPAKKQEQD
Donor tissue: tailbud