ORFeome > dnajc9 – XORFeome 2.0

dnajc9 – XORFeome 2.0

General Information

Species: Xenopus tropicalis DnaJ (Hsp40) homolog, subfamily C, member 9, mRNA (cDNA clone MGC:76175 IMAGE:5335649), complete cds
Gene Symbol: dnajc9
Gene ID: 394914
ORF gb_acc: MG132690
ORF ID: 9980

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064229

Library Location

Plate ID: GDExt11001
Well Location: D07

EST Sequences

Clone: MGC:76175 IMAGE:5335649
Trimmed Sequence: ATGCCGGGCCTGCGGGAGAGCTGCGAGATACACTTTGGTACTTCGGACCTTTACAAAGTGCTTGGAGTGCGCAAAGAAGCGGGGGAAGGGGAGATACGGCGCGGGTATCACCGGGTATCATTAAAGGTGCACCCCGATCGGGTTCAACAAGAAGAGAAAGAAAATGCCACTGCCGAGTTCCAGATACTTGGAAAGGTTTATGCAGTTCTCAGTGATAAGGAGCAGCGAGCCCTGTACGATGAGCAGGGTATTGTTGATGAAGAAACAGATACACTGAGTCAGGATAAAAACTGGGAGGAATATTGGAGGTTGCTGTTTAAAAAGATAACTGTGGAAGATATAAAGGCATACGAAGAAAAGTACAAAGGCTCAGAAGAAGAAAAGAATGATATTATATCGGCTTATATGGACTTTGAGGGAAATATGGATGGCATTATGGAGTCTGTGCCATGTGCAGATTTTGAGGATGAACCAAGAATTAGACATATAATTCAGAAAGCCATTAAATCCAAAGAAATTCCTTCCTACAACGCTTTTGTTAAAGAGTCTAAAAAGAAACGTGAACAAAGAAACAAACGGGCTCACGAGGAAGCAAAAGAAGCAGAAGAAATTAAAAAGGAAATGGGCCTTGGTGATGACAGTGATGACCTTAAGGCGCTCATACAAAGACGGCAGAATGATCGAAAAAAAGAAATGGACAGTTTCTTTGATCAGTTGGAAGCAAAATACTGCAATACTTCCAAAAAAGCAACAAGCAAATCCAAGGCACCAAAGAAAGGGAAAAAGTGA
Full Trace Sequence: cacaatgccgggcctgcgggagagctgcgagatacactttggtacttcggacctttacaaagtgcttggagtgcgcaaagaagcgggggaaggggagatacggcgcgggtatcaccgggtatcattaaaggtgcaccccgatcgggttcaacaagaagagaaagaaaatgccactgccgagttccagatacttggaaaggtttatgcagttctcagtgataaggagcagcgagccctgtacgatgagcagggtattgttgatgaagaaacagatacactgagtcaggataaaaactgggaggaatattggaggttgctgtttaaaaagataactgtggaagatataaaggcatacgaagaaaagtacaaaggctcagaagaagaaaagaatgatattatatcggcttatatggactttgagggaaatatggatggcattatggagtctgtgccatgtgcagattttgaggatgaaccaagaattagacatataattcagaaagccattaaatccaaagaaattccttcctacaacgcttttgttaaagagtctaaaaagaaacgtgaacaaagaaacaaacgggctcacgaggaagcaaaagaagcagaagaaattaaaaaggaaatgggccttggtgatgacagtgatgaccttaaggcgctcatacaaagacggcagaatgatcgaaaaaaagaaatggacagtttctttgatcagttggaagcaaaatactgcaatacttccaaaaaagcaacaagcaaatccaaggcaccaaagaaagggaaaaagtgatttctgtatgagatttctgtgtgagattgtatttgttaaatgaaatgtaaaactttactgagatggatatctgtccttaggttgtaccaaatagcctttgcccaaatgggttcgtagctttgtggatctaagagtgcgccattctcagaactgcagttgcaaatgatgtagtttgtccttggagttcagttttaatttttgcttgaaactgttcaaaggattcaaaaaccttatttagcatgctctgcattgcacagctaaggcttctctcatggccaaagcagcaacacatttagtttgttgtacagatctgattaaaacaattagtgcttttcagttcattccgtgtacaaagacatcaggttgttccaactgagtttataggcaaaaccctatttaaaaaaaaaaaaaaaaataaataaaagccactggttataaaatgattgtgacgttttataagcctacaatttagtttactcagcaaattccagcatttatccgatttgtataccaagcaaacaagaactccatttattacatttagctccatgagctttattggtctctttaataggaattggcagaacgtatatttgtgtgtgtgtgtgtgtgtgtgtgtgtgtagctgcacttaacttttaaacataaattgaaaaatccaaaccaataaaatattttgctaacatctaaaaaaaaaataaaaacaaaaaaaaaaaaaaaaaaaa
Translation: MPGLRESCEIHFGTSDLYKVLGVRKEAGEGEIRRGYHRVSLKVHPDRVQQEEKENATAEFQILGKVYAVLSDKEQRALYDEQGIVDEETDTLSQDKNWEEYWRLLFKKITVEDIKAYEEKYKGSEEEKNDIISAYMDFEGNMDGIMESVPCADFEDEPRIRHIIQKAIKSKEIPSYNAFVKESKKKREQRNKRAHEEAKEAEEIKKEMGLGDDSDDLKALIQRRQNDRKKEMDSFFDQLEAKYCNTSKKATSKSKAPKKGKK
Donor tissue: tailbud