ORFeome > eif4ebp2 – XORFeome 2.0

eif4ebp2 – XORFeome 2.0

General Information

Species: Xenopus tropicalis eukaryotic translation initiation factor 4E binding protein 2, mRNA (cDNA clone MGC:75579 IMAGE:5379119), complete cds
Gene Symbol: eif4ebp2
Gene ID: 394958
ORF gb_acc: MG132777
ORF ID: 10092

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064150

Library Location

Plate ID: GDExt11002
Well Location: F06

EST Sequences

Clone: MGC:75579 IMAGE:5379119
Trimmed Sequence: ATGTCAGCCGGACACCAGCACAGCCAGAGCCGGGCCATCCCCACTAGGACCATCCCCATCAGCGACTCCTCTCAGCTACCTCATGACTATTGCACCACCCCCGGGGGCACCCTCTTCTCCACCACCCCTGGAGGTACTCGTATCATATATGATCGCAAGTTTCTCTTGGACCGTCGCAACTCCCCTCTGGCTCAGACACCTCCTCGCCGCCTGCCAGATATTCCAGGAGTAACCAGCCCTAACACTGCTGTAGAGGAATCCAAAGTAGAAACAAACAACTTGAACAATCATGACACAAAGACAGCAGCAGGTGATGATTCTCAGTTTGAAATGGACATCTGA
Full Trace Sequence: ctgtttcccggtacagggagtgagcttggagggcggaggagataggaacagggagagagaaggaagggaaaaagaaaagggcacaccagccaatcctcccccttgcctcagccggctccgcccagtccctgctcggctttctttctctctccctccccctctagcacccacaccacacactgtcccaggccaggaacatgtcagccggacaccagcacagccagagccgggccatccccactaggaccatccccatcagcgactcctctcagctacctcatgactattgcaccacccccgggggcaccctcttctccaccacccctggaggtactcgtatcatatatgatcgcaagtttctcttggaccgtcgcaactcccctctggctcagacacctcctcgccgcctgccagatattccaggagtaaccagccctaacactgctgtagaggaatccaaagtagaaacaaacaacttgaacaatcatgacacaaagacagcagcaggtgatgattctcagtttgaaatggacatctgatctcctggatgtttggcaacagctcccgaaacttgcgtgtacctaacttggccaataggatcatttattgaagaaaggaaaagagaaaaaaaaagtctgatgcacagctttgaaattaaacctgccctcccaggtgccaaaggtcaacgcaaataagcatttccaccttgtccctaaagactgtaataacccacctcaactagcattgtgtctgtgtgggggtggagagacttgtaactgaaaattcagtggcctaattttggcaaagggaaagagatacagtttgccaatgtgtactgtagctgtctggaaaatatatgtaaatggttggtggcaggaatgaaaattgtacacttatgctttctatacactttttttttctcccctcacccacccaaatatttttgtgttattcctactaaatgattacagcatggaatgctgtggctgctgtgggtatttttgtgtggattctttcaatagccgattttctcatgcagtactgcttacgtagctctcgtttgggaaaacaaaagttgtttctgaatgccacaacttaagtcctctatttaggagccctttgttgtgggtcatccaagggacccatctagctgaccacggatagccctttcatatattagggccctaatcaaactaagcatcagtcaacaatgtttaacaaatctattcaacaaccttatgtcaggtttggttgatcaaatcaggcaaaatttaagttaatttggtcaggctaaaatttttttttttttgggtgttgccttgcttcttcttgctcttatgtcagtcaacaaaagagcaacatgattgccaggtccagggaatgcaggcaaatgtttccccatggatattcagctttaaatatgggccaccttaagctgtttcatttagttcctgaaaacctaacctttgggcctaatatgttttacaggttactactctttaaataagctgcaagttatcatattccactgttgtataaaagacccatttaaatgtacattgtacctaataggtagtgcataattcatttggtctgaactatatatagattataacatttcttaacaaaatgctccacatgacgtcaaaccactttgagttatttcatcaagttgactaaaacctatagctaagaaaaaaaaaaaaaaaaa
Translation: MSAGHQHSQSRAIPTRTIPISDSSQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPLAQTPPRRLPDIPGVTSPNTAVEESKVETNNLNNHDTKTAAGDDSQFEMDI
Donor tissue: tailbud