ORFeome > ensa – XORFeome 2.0

ensa – XORFeome 2.0

General Information

Species: Xenopus tropicalis endosulfine alpha, mRNA (cDNA clone MGC:69262 IMAGE:5308162), complete cds
Gene Symbol: ensa
Gene ID: 407936
ORF gb_acc: MG133225
ORF ID: 10695

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC067944

Library Location

Plate ID: GDExt11006
Well Location: D09

EST Sequences

Clone: MGC:69262 IMAGE:5308162
Trimmed Sequence: ATGTCCGATAAATACATTGGCGACTCGCACCTGGAAGAGACCGGCGAGGAGAAGCAGGACTCGCAAGAAAAGGAAGCGGTGACTCCAGAAAAAGCAGAGGAGCAAAAATTGAAAGCCAAATATCCCAATTTAGGACAGAAACCTGGAGGTTCAGACTTCCTGATGAAAAGGCTTCAAAAAGGACAAAAGTACTTTGACTCAGGTGACTACAACATGGCCAAGGCCAAGATGAAGAACAAACAGCTGCCATGCGCAGGGCCAGACAAGAACCTGGTAACTGGAGACCACATCCCTACGCCACAGGACCTTCCGCAGAGGAAGTCTTCACTGGTGACCAGCAAGCTAGCGGGGCATGTCGAGGACTTGCACCAGGTGTAG
Full Trace Sequence: cgcccattcagtccgtctcgctttctcattgatcgagcgctttgccgtcaaaactataggaggcccgttgccttggtttccaactcctattggacaggcgtgacgtaatgtcccactctgattggctactggctatccgcctagcggcgggggagactgggcccgccattctagtctgtgacgtcaggcgcggtggccgccattttggagcggagtgagtggagtcggacggactgaggcgcccggcgggagagccgttatcttccgttcgcttccctttcccccttatagccggtaacatgtccgataaatacattggcgactcgcacctggaagagaccggcgaggagaagcaggactcgcaagaaaaggaagcggtgactccagaaaaagcagaggagcaaaaattgaaagccaaatatcccaatttaggacagaaacctggaggttcagacttcctgatgaaaaggcttcaaaaaggacaaaagtactttgactcaggtgactacaacatggccaaggccaagatgaagaacaaacagctgccatgcgcagggccagacaagaacctggtaactggagaccacatccctacgccacaggaccttccgcagaggaagtcttcactggtgaccagcaagctagcggggcatgtcgaggacttgcaccaggtgtagagacagtgacgccgatacagtggtgctcccccggacgctattgcgtcggcccaacagaacgaacaaagtgaaacctttcaaggcggacaatcaccactcaacttgtcgaggaaggccttcttgcatggaaaggggcacccatgcacccgcagaactttctaactagaacgtgtaagataatagagtttgtgaaatccactacatctcatgtacgagtctggaaccgggtggatgtcgacggctcgtggtttatttcgaagctcggaagagtgttgcgacgcatctccatcactgccctgctgattaggacagtcattcagtcccaaagccaatcctacgcaggggttgtattaactgctgatatttaatctttcattccaacatgctgtaaagtgaaagccattggcccctgagcaggagatatagaaaattaggacacattcagctatcccaattataccgtaagaaaattaatagcatcacaagagggtttgctaactcatatcacgtttttttgccctacatttcactacaggaaataattgaaatatttccaaatatgtttcccgttcggcagtgccatacatggcatacatttgatttggcttcatgagaaaatctgctgtggtgcaggcttccttatgggacagggctgcaccgtcgtgccgactgcccaagcttcattgtgctttctaattatccaatgtgcatatgccaaggacatccagtggagaccaagccaccatggaattttacactgcacggcaatattagctagtgagaagcaatactctcatttaataagaatctctgtgagggtcacacaagtccctaatagttgcctgttagatatatagaaatatatatattttacagccataacctggacacagggacagtagttgcccccataaatggcacgacggtcagcctttattctcatgttgaatccctgctttgtgacactgagagtctgctttacagtccaaatcagtagatttcattaagtgcataaaagaatctcctaagtggtcgtagaagaaacgtatcctttatggcaaagtcagtccttaaggcttttcctatttgtaggccaaacgtgtctgtgtgagaggaaaaccttgggtgagtttggccagaatcatgcccatgtttgtaatatcagcatctgttaatcccccagggcacgcgctggcaaacaacatggagtggaaaataggccacgcccgaatgatcattatccaataaacaggccgcactcctatgagagcaagctctatgtttatgctcttggagcaatgttatgtaaatctgggaataaatcacattaaaatgttaaatttacttgttaaataaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSDKYIGDSHLEETGEEKQDSQEKEAVTPEKAEEQKLKAKYPNLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPCAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGHVEDLHQV
Donor tissue: gastrula