ORFeome > ftsj3 – XORFeome 2.0

ftsj3 – XORFeome 2.0

General Information

Species: Xenopus tropicalis FtsJ homolog 3, mRNA (cDNA clone MGC:147476 IMAGE:7847301), complete cds
Gene Symbol: ftsj3
Gene ID: 779882
ORF gb_acc: MG135607
ORF ID: 13703

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC121672

Library Location

Plate ID: GDExt11035
Well Location: A09

EST Sequences

Clone: MGC:147476 IMAGE:7847301
Trimmed Sequence: ATGGGCAAGAAAGCAAAGGTTGGAAAGAGCCGAAAGGATAAATTCTATCATTTGGCTAAAGAGACTGGGTACCGGTCTCGTTCAGCCTTCAAGCTTATTCAGCTAAACAGAAAATTTCAATTCTTGCCAAAAGCACGTGCTCTGGTGGATCTGTGTGCTGCACCAGGAGGCTGGCTTCAAGTTGCAGCAAAGTTTATGCCAATATCCAGTCTTATTATAGGAGTAGACCTAGTACCCATAAAACCAATTCCTAAAGTATTGACTCTACAGGAAGATATAACCACTGAAGCCTGCAGACAGACTGTAAGGAAGCATTTGCAGACATGGAAGGCAGATGTGGTTCTGAATGATGGTGCACCAAATGTTGGAGCCAACTGGACACATGATGCTTTCTCACAAGTGCACCTCTCTCTTATGGCACTTCGTCTAGCCTGTGATTGTCTCTCAAGAGGTGGTTGGTTCATTACTAAAATATTCCGTTCATCTGATTATCAGTCACTGCTCTGGATTCTACAGCAGTTTTTTAAGAAAGTGAATTCCACCAAGCCCCAGGCCTCTCGCAGCGAAAGTGCAGAGATCTTCGTCGTATGCCAGGGTTTTTTGGCTCCAGATAAAATAGACACCAGATTCTTTGACCCAAAATTTGCATTTAAGGATGTGGATGGTCCTGTGCAGACTGTGTCTCAACTGTTGTCTCATAAGAAACCAAAGGCAGAAGGTTATGCTGCTACATCTCTTTCTCTATATCATCGTGCCTCATTGGTTGACTTTCTTACAGTGGAGAATCCTGTTGACTTTCTCTCAAAAACCAGCGAGGTAACTAATGAGCCTGAATGGAAAAATAGTGTAACTTTGTTTTATGTATCTAATGTAATATGCAAAATAGTCTATATGTAA
Full Trace Sequence: ctaagatgggcaagaaagcaaaggttggaaagagccgaaaggataaattctatcatttggctaaagagactgggtaccggtctcgttcagccttcaagcttattcagctaaacagaaaatttcaattcttgccaaaagcacgtgctctggtggatctgtgtgctgcaccaggaggctggcttcaagttgcagcaaagtttatgccaatatccagtcttattataggagtagacctagtacccataaaaccaattcctaaagtattgactctacaggaagatataaccactgaagcctgcagacagactgtaaggaagcatttgcagacatggaaggcagatgtggttctgaatgatggtgcaccaaatgttggagccaactggacacatgatgctttctcacaagtgcacctctctcttatggcacttcgtctagcctgtgattgtctctcaagaggtggttggttcattactaaaatattccgttcatctgattatcagtcactgctctggattctacagcagttttttaagaaagtgaattccaccaagccccaggcctctcgcagcgaaagtgcagagatcttcgtcgtatgccagggttttttggctccagataaaatagacaccagattctttgacccaaaatttgcatttaaggatgtggatggtcctgtgcagactgtgtctcaactgttgtctcataagaaaccaaaggcagaaggttatgctgctacatctctttctctatatcatcgtgcctcattggttgactttcttacagtggagaatcctgttgactttctctcaaaaaccagcgaggtaactaatgagcctgaatggaaaaatagtgtaactttgttttatgtatctaatgtaatatgcaaaatagtctatatgtaatatatatgttaaaaaaagggttcacacattccactgcctcagccagtgtaaaaatgttttctcacatcttgagctaataacaccaatgcacagaagcttacaaagtataattcagtactgtttagtactattttgtattatttagctgaatagcagtttaatgaataatgttatggcaaaaatgtaaaaaaattaaccaggtatatataataaagtgtgatacttttctaaaaaaaaaaaaaaaaaa
Translation: MGKKAKVGKSRKDKFYHLAKETGYRSRSAFKLIQLNRKFQFLPKARALVDLCAAPGGWLQVAAKFMPISSLIIGVDLVPIKPIPKVLTLQEDITTEACRQTVRKHLQTWKADVVLNDGAPNVGANWTHDAFSQVHLSLMALRLACDCLSRGGWFITKIFRSSDYQSLLWILQQFFKKVNSTKPQASRSESAEIFVVCQGFLAPDKIDTRFFDPKFAFKDVDGPVQTVSQLLSHKKPKAEGYAATSLSLYHRASLVDFLTVENPVDFLSKTSEVTNEPEWKNSVTLFYVSNVICKIVYM
Donor tissue: muscle